(data stored in ACNUC7421 zone)

EMBL: CP000094.TATA

CP000094.TATA        Location/Qualifiers
FT   CDS             complement(437342..437620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="Pfl01_0382"
FT                   /product="putative Sec-independent protein translocase
FT                   protein, TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72126"
FT                   /db_xref="GOA:Q3KJD0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD0"
FT                   /protein_id="ABA72126.1"
FT                   /translation="MGIFDWKHWIVILVVVVLVFGTKKLKNLGTDVGESIKGFRKAMND
FT                   DEKPADPTVTPAQPVPPVQPQATAQANPPHTIDVQAQKVEEPIRKDV"
     MGIFDWKHWI VILVVVVLVF GTKKLKNLGT DVGESIKGFR KAMNDDEKPA DPTVTPAQPV        60
     PPVQPQATAQ ANPPHTIDVQ AQKVEEPIRK DV                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page