(data stored in ACNUC7421 zone)

EMBL: CP000094.TATB

CP000094.TATB        Location/Qualifiers
FT   CDS             complement(436885..437331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="Pfl01_0381"
FT                   /product="Sec-independent protein translocase protein,
FT                   TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72125"
FT                   /db_xref="GOA:Q3KJD1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJD1"
FT                   /protein_id="ABA72125.1"
FT                   /translation="MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWVGRLKRSFNA
FT                   IKQEVEREIGADEIRRQLHNEHILSLEQEARKIFTPVQQEPTPVEHVGEQTIHSPAAPT
FT                   PAAPAVAPTESAPVVAPASVEHVAQTAAPTTPAPNDTTQPPRAP"
     MFGISFSELL LVGLVALLVL GPERLPGAAR TAGLWVGRLK RSFNAIKQEV EREIGADEIR        60
     RQLHNEHILS LEQEARKIFT PVQQEPTPVE HVGEQTIHSP AAPTPAAPAV APTESAPVVA       120
     PASVEHVAQT AAPTTPAPND TTQPPRAP                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page