(data stored in ACNUC30630 zone)

EMBL: CP000113.ATPF

CP000113.ATPF        Location/Qualifiers
FT   CDS             465378..465896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="MXAN_0404"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89279"
FT                   /db_xref="GOA:Q1DF98"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DF98"
FT                   /protein_id="ABF89279.1"
FT                   /translation="MKVQPGLIFWTLVTFVIAAVVLKWKAWGPILSLVEEREKQIASSI
FT                   ESAKRERAEAEKLLADQKTAIAEARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKL
FT                   SARREIDEQKAKAIAEVRSMAVDLAMEVAGKLISERMDDSKQRALAEQFVQGLPLNSTS
FT                   ATGAVRRTA"
     MKVQPGLIFW TLVTFVIAAV VLKWKAWGPI LSLVEEREKQ IASSIESAKR ERAEAEKLLA        60
     DQKTAIAEAR REAAEMMRRN TQEMEKFREE LMAKSRKEAE ELKLSARREI DEQKAKAIAE       120
     VRSMAVDLAM EVAGKLISER MDDSKQRALA EQFVQGLPLN STSATGAVRR TA               172
//

If you have problems or comments...

PBIL Back to PBIL home page