(data stored in ACNUC30630 zone)

EMBL: CP000113.CLS

CP000113.CLS         Location/Qualifiers
FT   CDS             127779..129026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="MXAN_0110"
FT                   /product="cardiolipin synthase"
FT                   /note="identified by similarity to SP:P31071; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86832"
FT                   /db_xref="GOA:Q1DG30"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG30"
FT                   /protein_id="ABF86832.1"
FT                   /translation="MKLAWLVPVVLIAAGCPAPNHRHDLRLRALPGTSPEARSLAFFQS
FT                   LGVALVPGHRVELVENGFIFDAIEEEILAARTSIHIISYIWRPGEPSDRLVRALAARRP
FT                   GVACRVLVDPLGSVNFEAVIPALAASGCDARYFRPIQGDFVALDAVRLRARNHRKMVVR
FT                   DGEVGITGGWGIWKSWMGNAQSAESWRDMNIRVEGPAVREMQVAFAQNWQEAGGDFLPA
FT                   TDFPEPRYAGDARAGFVASTDNRFLSDARRMTLLTIAAAQERLWIANSYFIPSDAISDM
FT                   LLEKVKQGVDVRVLVPGRHHDVGPVNAAQRASYARLLEGGVRIWEYELSMMHSKTMLVD
FT                   DSLSVVGSTNMDPLALTTLEECSVVVEDVALAAQLAASFEKDLRHSREIHWSGWKRRGL
FT                   LQKLGERLPWFIGSFL"
     MKLAWLVPVV LIAAGCPAPN HRHDLRLRAL PGTSPEARSL AFFQSLGVAL VPGHRVELVE        60
     NGFIFDAIEE EILAARTSIH IISYIWRPGE PSDRLVRALA ARRPGVACRV LVDPLGSVNF       120
     EAVIPALAAS GCDARYFRPI QGDFVALDAV RLRARNHRKM VVRDGEVGIT GGWGIWKSWM       180
     GNAQSAESWR DMNIRVEGPA VREMQVAFAQ NWQEAGGDFL PATDFPEPRY AGDARAGFVA       240
     STDNRFLSDA RRMTLLTIAA AQERLWIANS YFIPSDAISD MLLEKVKQGV DVRVLVPGRH       300
     HDVGPVNAAQ RASYARLLEG GVRIWEYELS MMHSKTMLVD DSLSVVGSTN MDPLALTTLE       360
     ECSVVVEDVA LAAQLAASFE KDLRHSREIH WSGWKRRGLL QKLGERLPWF IGSFL            415
//

If you have problems or comments...

PBIL Back to PBIL home page