(data stored in ACNUC30630 zone)

EMBL: CP000113.DPP4

CP000113.DPP4        Location/Qualifiers
FT   CDS             573724..576012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpp4"
FT                   /locus_tag="MXAN_0515"
FT                   /product="dipeptidyl peptidase IV"
FT                   /EC_number="3.4.14.5"
FT                   /note="identified by similarity to GB:BAA11872.1; match to
FT                   protein family HMM PF00326; match to protein family HMM
FT                   PF00930"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88767"
FT                   /db_xref="GOA:Q1DEY9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY9"
FT                   /protein_id="ABF88767.1"
FT                   /translation="MGSSLSRNMAMPSSRRVMSHHSGDSSHTPMRILLTALVLLSAPVL
FT                   AQPKSVPTPKAAPKSDGFIRQLVETRYFNIGRPMGTSFTPDEQTLFFLRNPEGSRALAL
FT                   HAFDVATGQTREHLTAERLLQRARENLAVEPKARQEPARVSSRGLSSYALSEDGEKLLV
FT                   GLSGKQYIVTRASGKVTELKTGPGAMDVRFSPDATQVAYVRGHDVYRLDLATNIEHQVT
FT                   KGGTEEKSHGLAEFIATSEMMRFSGYWWSPDGKALAYTESDTSGVEKLAIADALHPEND
FT                   ARRLAFPRAGKANARVRLGIIPITGGKTTWVRWDVEKYPYLATVRWPAKGPLTVLVQNR
FT                   LQTEELLLAVDPRTGSTRTLLVERDDAWLTLHQTFPHWLEDGSGFLWYTERNGAGEVEL
FT                   RDASGKFVRSLVPPGAGFYDMAGYVEKDGTVYFTGGPTSDERYVWRLSPGGRPTRVTSE
FT                   SPALELARMSKRGGLLAITSEGPRRMRHTTVMKADGTRVGELPSVAMEPPFQPRVEVRY
FT                   VGKERYPTSLVRPRDAKPGVKLPVIVDIYAGPGIPMVYQSMQQHLTNQWLADEGFIVVK
FT                   LDGRGVSPTADAKLRKPKYDWPRLLLDEQVAALRALAAEVPEMDLSRVGITGASNGGYM
FT                   SALAVLTRPDVFKAAVAVSSVTDWRDYDSHLTERFFGLPDEHPQAYEQASLLTHVKADQ
FT                   PMGKLLFIHGTADDNVLFFHALKLSDALFRAGQPHEFLPLSGMPHMVFDPVLAERMWEE
FT                   TARYFKRHL"
     MGSSLSRNMA MPSSRRVMSH HSGDSSHTPM RILLTALVLL SAPVLAQPKS VPTPKAAPKS        60
     DGFIRQLVET RYFNIGRPMG TSFTPDEQTL FFLRNPEGSR ALALHAFDVA TGQTREHLTA       120
     ERLLQRAREN LAVEPKARQE PARVSSRGLS SYALSEDGEK LLVGLSGKQY IVTRASGKVT       180
     ELKTGPGAMD VRFSPDATQV AYVRGHDVYR LDLATNIEHQ VTKGGTEEKS HGLAEFIATS       240
     EMMRFSGYWW SPDGKALAYT ESDTSGVEKL AIADALHPEN DARRLAFPRA GKANARVRLG       300
     IIPITGGKTT WVRWDVEKYP YLATVRWPAK GPLTVLVQNR LQTEELLLAV DPRTGSTRTL       360
     LVERDDAWLT LHQTFPHWLE DGSGFLWYTE RNGAGEVELR DASGKFVRSL VPPGAGFYDM       420
     AGYVEKDGTV YFTGGPTSDE RYVWRLSPGG RPTRVTSESP ALELARMSKR GGLLAITSEG       480
     PRRMRHTTVM KADGTRVGEL PSVAMEPPFQ PRVEVRYVGK ERYPTSLVRP RDAKPGVKLP       540
     VIVDIYAGPG IPMVYQSMQQ HLTNQWLADE GFIVVKLDGR GVSPTADAKL RKPKYDWPRL       600
     LLDEQVAALR ALAAEVPEMD LSRVGITGAS NGGYMSALAV LTRPDVFKAA VAVSSVTDWR       660
     DYDSHLTERF FGLPDEHPQA YEQASLLTHV KADQPMGKLL FIHGTADDNV LFFHALKLSD       720
     ALFRAGQPHE FLPLSGMPHM VFDPVLAERM WEETARYFKR HL                          762
//

If you have problems or comments...

PBIL Back to PBIL home page