(data stored in ACNUC30630 zone)

EMBL: CP000113.FHS

CP000113.FHS         Location/Qualifiers
FT   CDS             complement(210960..212615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="MXAN_0175"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="identified by similarity to SP:Q59925; match to
FT                   protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87836"
FT                   /db_xref="GOA:Q1DFW5"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFW5"
FT                   /protein_id="ABF87836.1"
FT                   /translation="MTLRAMTDVGAELGLSPEDVLPWGTHRAKVSLDALGKRGGRQGRL
FT                   VLVSAINPTPPGEGKTTMSVALAMGLRKRGRRAVAALREPSLGPVFGVKGGGTGGGQAS
FT                   LEPAADINLHFTGDLHAITSANNLLSALVDNAVFYGQPVALDATRVRWRRALDMNDRFL
FT                   RNVIVGLGGKAQGVPREDHFDITAASEVMAILALAEGLKDLEARLGRVIIGHTRDGQPV
FT                   RARDVDAAASMVALLKDALMPNLAQTREGGPALVHAGPFANIAHGCSSVMGTRMGLAYA
FT                   DEVITEAGFGFDLGAEKFLDIKCRGSGLWPRGVVLVVTLRALKHHGGASPARVAEPDRE
FT                   ALVRGFAHLEKHLESVAAFGLPAVLCVNRFPQDTESELEELRAFGKARGVETAVCDGFS
FT                   RGGDGSLELADCVLEMLDGTDAAPPQPRFLYDVAQTPEEKVAAIARTVYGADDVAFTAS
FT                   AKKDLDAIRELGGAGLPVCMAKTHLSLSDDPTKLGRPRGFTLTVREVRLSAGAGFMVAL
FT                   TGEILTMPGLPREPAARRVTVHDDGRVTGLMQGE"
     MTLRAMTDVG AELGLSPEDV LPWGTHRAKV SLDALGKRGG RQGRLVLVSA INPTPPGEGK        60
     TTMSVALAMG LRKRGRRAVA ALREPSLGPV FGVKGGGTGG GQASLEPAAD INLHFTGDLH       120
     AITSANNLLS ALVDNAVFYG QPVALDATRV RWRRALDMND RFLRNVIVGL GGKAQGVPRE       180
     DHFDITAASE VMAILALAEG LKDLEARLGR VIIGHTRDGQ PVRARDVDAA ASMVALLKDA       240
     LMPNLAQTRE GGPALVHAGP FANIAHGCSS VMGTRMGLAY ADEVITEAGF GFDLGAEKFL       300
     DIKCRGSGLW PRGVVLVVTL RALKHHGGAS PARVAEPDRE ALVRGFAHLE KHLESVAAFG       360
     LPAVLCVNRF PQDTESELEE LRAFGKARGV ETAVCDGFSR GGDGSLELAD CVLEMLDGTD       420
     AAPPQPRFLY DVAQTPEEKV AAIARTVYGA DDVAFTASAK KDLDAIRELG GAGLPVCMAK       480
     THLSLSDDPT KLGRPRGFTL TVREVRLSAG AGFMVALTGE ILTMPGLPRE PAARRVTVHD       540
     DGRVTGLMQG E                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page