(data stored in ACNUC30630 zone)

EMBL: CP000113.GYRB

CP000113.GYRB        Location/Qualifiers
FT   CDS             312232..314679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MXAN_0264"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87299"
FT                   /db_xref="GOA:Q1DFM8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFM8"
FT                   /protein_id="ABF87299.1"
FT                   /translation="MEKTPATGSAVAPPPVEYGTDSITKLEGREAVRKRPGMYIGDTMA
FT                   YGLHKLVYEVVDNAVDESLAGHCTDIEVVIHVDGSLSVQDNGRGIPVGPHPKFPGKDTL
FT                   EVVLTELHAGSKFGNGAYKVSGGLHGVGVTCVNFLSEWFKVRVHRNGIVYEQAYAQGVP
FT                   DTPPREVGTTDKRGTHIAFKPDATVMELVEFNFETLSQRLRELAFLNAGLHIVVRDERT
FT                   NKEHDFKFDGGISSFVEYLNKSKQTLHDKPISFSTEREGVMLDIAMQWNDGYDERIYTF
FT                   ANNINTHEGGSHLSGFKAALTRTLNSYAEKGSLWKDLKETPTGEDAREGLSAVISVKLT
FT                   NPQFEGQTKTKLGNSEVKGLVEQMVNDQLGSFLEETPMVAKKVVAKIGDACRARLAARK
FT                   ARETVRRKGVLDGGGLPGKLADCQSRDPNESELYIVEGDSAGGSAKQGRDRRNQAILPL
FT                   RGKILNVEKARFEKMLTSAEIVTLITALGTGIGAEDYDPEKARYHRIILMTDADVDGSH
FT                   IRTLLLTFFFRQMPELLQKGYLYIAQPPLYKVTRNKKDQYVKDEHALNEYLLKIASEHA
FT                   RVLTPGGELGGAELKALLEKVITYEERLEKQAKRRDARVVDALVQGARLSAETLTDEAA
FT                   LEAAVKAAYDTFERRMPDVLGRVRHELVQDPEHHTKKLVFHTDVNGAMRETVLDHAFLS
FT                   SPEYLELSSLRDAFVALGKAPYKVRVDAGEITVFSVQEVLAAVRKDAQRGLGLQRYKGL
FT                   GEMNPEQLWDTTMNPATRTLLQVRVEDAVESDEIFSLLMGEAVEPRREFIERNALDVQN
FT                   LDI"
     MEKTPATGSA VAPPPVEYGT DSITKLEGRE AVRKRPGMYI GDTMAYGLHK LVYEVVDNAV        60
     DESLAGHCTD IEVVIHVDGS LSVQDNGRGI PVGPHPKFPG KDTLEVVLTE LHAGSKFGNG       120
     AYKVSGGLHG VGVTCVNFLS EWFKVRVHRN GIVYEQAYAQ GVPDTPPREV GTTDKRGTHI       180
     AFKPDATVME LVEFNFETLS QRLRELAFLN AGLHIVVRDE RTNKEHDFKF DGGISSFVEY       240
     LNKSKQTLHD KPISFSTERE GVMLDIAMQW NDGYDERIYT FANNINTHEG GSHLSGFKAA       300
     LTRTLNSYAE KGSLWKDLKE TPTGEDAREG LSAVISVKLT NPQFEGQTKT KLGNSEVKGL       360
     VEQMVNDQLG SFLEETPMVA KKVVAKIGDA CRARLAARKA RETVRRKGVL DGGGLPGKLA       420
     DCQSRDPNES ELYIVEGDSA GGSAKQGRDR RNQAILPLRG KILNVEKARF EKMLTSAEIV       480
     TLITALGTGI GAEDYDPEKA RYHRIILMTD ADVDGSHIRT LLLTFFFRQM PELLQKGYLY       540
     IAQPPLYKVT RNKKDQYVKD EHALNEYLLK IASEHARVLT PGGELGGAEL KALLEKVITY       600
     EERLEKQAKR RDARVVDALV QGARLSAETL TDEAALEAAV KAAYDTFERR MPDVLGRVRH       660
     ELVQDPEHHT KKLVFHTDVN GAMRETVLDH AFLSSPEYLE LSSLRDAFVA LGKAPYKVRV       720
     DAGEITVFSV QEVLAAVRKD AQRGLGLQRY KGLGEMNPEQ LWDTTMNPAT RTLLQVRVED       780
     AVESDEIFSL LMGEAVEPRR EFIERNALDV QNLDI                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page