(data stored in ACNUC30630 zone)

EMBL: CP000113.KDPA

CP000113.KDPA        Location/Qualifiers
FT   CDS             197788..199509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="MXAN_0164"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by similarity to SP:P03959; match to
FT                   protein family HMM PF03814; match to protein family HMM
FT                   TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90399"
FT                   /db_xref="GOA:Q1DFX6"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX6"
FT                   /protein_id="ABF90399.1"
FT                   /translation="MSFIGWSQILLFFALVLAVTKPLGAYLFRVLEGDTRPLPRVLGPL
FT                   ERLLLRLCGAADRHEQTWVAYASSLLAFSLFSVLIVYGLQRVQHLLPLNPQGLGAVGPE
FT                   LAFNTAVSFTANTNWQSYAGESTLSYLTQMVALAWQNFVSAAAGIGVALALARGFTRRP
FT                   GPDGQKTLGNFWVDVMNATLYVLLPLSLLYALFLVSQGVLQNFAPYAQVVTLEGASQTL
FT                   AQGPVASQEAIKTLGTNGGGFFNANSAHPFENPTPFTNLVQMLSIFAIPAALTYTYGKM
FT                   AGDTRQGWALLSAMSVLFLVGVAAVYAAESQANPALSVAGQVAQAGNMEGKEVRYGIAA
FT                   SSLFAAVTTAASCGAVNAMHDSFTPLGGLVPMVNMQLGEVVFGGVGAGLYGILVMVVLS
FT                   VFIAGLMVGRTPEYLGKKIEAREMKLAMLYVLVFPLFTLGFSGLAAVLPQGVSSLNNAG
FT                   PHGLSEILYAYTSGTANNGSAFAGLNANTPFWNITLGVAMLGGRFLMMVPALAIAGSMV
FT                   GKKVVPAGPGTFPTHGVLFTGLLVSVIVIVGALTFFPALSLSPIVEHFLAGAGKRY"
     MSFIGWSQIL LFFALVLAVT KPLGAYLFRV LEGDTRPLPR VLGPLERLLL RLCGAADRHE        60
     QTWVAYASSL LAFSLFSVLI VYGLQRVQHL LPLNPQGLGA VGPELAFNTA VSFTANTNWQ       120
     SYAGESTLSY LTQMVALAWQ NFVSAAAGIG VALALARGFT RRPGPDGQKT LGNFWVDVMN       180
     ATLYVLLPLS LLYALFLVSQ GVLQNFAPYA QVVTLEGASQ TLAQGPVASQ EAIKTLGTNG       240
     GGFFNANSAH PFENPTPFTN LVQMLSIFAI PAALTYTYGK MAGDTRQGWA LLSAMSVLFL       300
     VGVAAVYAAE SQANPALSVA GQVAQAGNME GKEVRYGIAA SSLFAAVTTA ASCGAVNAMH       360
     DSFTPLGGLV PMVNMQLGEV VFGGVGAGLY GILVMVVLSV FIAGLMVGRT PEYLGKKIEA       420
     REMKLAMLYV LVFPLFTLGF SGLAAVLPQG VSSLNNAGPH GLSEILYAYT SGTANNGSAF       480
     AGLNANTPFW NITLGVAMLG GRFLMMVPAL AIAGSMVGKK VVPAGPGTFP THGVLFTGLL       540
     VSVIVIVGAL TFFPALSLSP IVEHFLAGAG KRY                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page