(data stored in ACNUC30630 zone)

EMBL: CP000113.LGT

CP000113.LGT         Location/Qualifiers
FT   CDS             complement(250000..250842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="MXAN_0205"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by similarity to SP:O34752; match to
FT                   protein family HMM PF01790"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88766"
FT                   /db_xref="GOA:Q1DFT6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT6"
FT                   /protein_id="ABF88766.1"
FT                   /translation="MGRSHPLEPPDVIPYWHAPSIELGPLKIEPFGILVAVGILLAARL
FT                   LGRNAEREGLNPEPLADFAPWGVGVGVVVGHWVHLFFYHPEELSKSPFQILKVWDGLSS
FT                   FGGLLGGILAAVVFFKVRKLRFSDYADSFALGVAPGWAVARLGCFAVHDHPGVPTDFFL
FT                   AVAFPGGPRHDLGMYDAMALFAISGVLYALRNAGKLKGRLLPLLAVLYAACRFFFDFLR
FT                   ATDMAYVDARYFGLTPAQYGCIALALYGIWGVLRPQAPGAASSPPPSSPKSPGTVGVR"
     MGRSHPLEPP DVIPYWHAPS IELGPLKIEP FGILVAVGIL LAARLLGRNA EREGLNPEPL        60
     ADFAPWGVGV GVVVGHWVHL FFYHPEELSK SPFQILKVWD GLSSFGGLLG GILAAVVFFK       120
     VRKLRFSDYA DSFALGVAPG WAVARLGCFA VHDHPGVPTD FFLAVAFPGG PRHDLGMYDA       180
     MALFAISGVL YALRNAGKLK GRLLPLLAVL YAACRFFFDF LRATDMAYVD ARYFGLTPAQ       240
     YGCIALALYG IWGVLRPQAP GAASSPPPSS PKSPGTVGVR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page