(data stored in ACNUC30630 zone)

EMBL: CP000113.MAC1

CP000113.MAC1        Location/Qualifiers
FT   CDS             642090..643769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mac1"
FT                   /locus_tag="MXAN_0559"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91443"
FT                   /db_xref="GOA:Q1DEU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU5"
FT                   /protein_id="ABF91443.1"
FT                   /translation="MAQNFIFTMQDLRKVKNGKEILKGIYLSFFPGAKIGVIGPNGSGK
FT                   STLLRIMAGVDTEFFGVAKPDPSAKVGYLAQEPQLDASLDVKGNVELGLKEIRATLDRF
FT                   NEVSAKFAEPMSDAEMEKLLAEQGRLQDAIDAVNGWELDRTIEMAMDALRLPPGDADVT
FT                   KLSGGEKRRVALCRILLEKPDLLLLDEPTNHLDAESVAWLEQALKEYKGTIVCITHDRY
FT                   FLDNAAEWILELDRGEGVPWKGNYSSWLEQKQKRLELEEKSESHRQKTLKRELEWVRAS
FT                   PKARQAKSKARIAAYEELLNQTQDKRDATGEVIIPPGPQLGGLVVEAKGLRKAYGDRLL
FT                   IEDLNFKLPRGGIVGVIGPNGAGKTTLFRMMTGVEKPDEGELNIGETVKLAYVDQSRDA
FT                   LDGDNSVFQEVSGGLDHLDLGKAGQVPSRAYLAGFAFKGQDQQKRVKDLSGGERNRVHL
FT                   AKMLKSGGNLLLLDEPTNDLDVETLRSLEDALLGFAGCAVVISHDRWFLDRIATHILAF
FT                   EGDSKAFFFEGNFEDYEADKKKRLGPEALEPHRIRYRPITKS"
     MAQNFIFTMQ DLRKVKNGKE ILKGIYLSFF PGAKIGVIGP NGSGKSTLLR IMAGVDTEFF        60
     GVAKPDPSAK VGYLAQEPQL DASLDVKGNV ELGLKEIRAT LDRFNEVSAK FAEPMSDAEM       120
     EKLLAEQGRL QDAIDAVNGW ELDRTIEMAM DALRLPPGDA DVTKLSGGEK RRVALCRILL       180
     EKPDLLLLDE PTNHLDAESV AWLEQALKEY KGTIVCITHD RYFLDNAAEW ILELDRGEGV       240
     PWKGNYSSWL EQKQKRLELE EKSESHRQKT LKRELEWVRA SPKARQAKSK ARIAAYEELL       300
     NQTQDKRDAT GEVIIPPGPQ LGGLVVEAKG LRKAYGDRLL IEDLNFKLPR GGIVGVIGPN       360
     GAGKTTLFRM MTGVEKPDEG ELNIGETVKL AYVDQSRDAL DGDNSVFQEV SGGLDHLDLG       420
     KAGQVPSRAY LAGFAFKGQD QQKRVKDLSG GERNRVHLAK MLKSGGNLLL LDEPTNDLDV       480
     ETLRSLEDAL LGFAGCAVVI SHDRWFLDRI ATHILAFEGD SKAFFFEGNF EDYEADKKKR       540
     LGPEALEPHR IRYRPITKS                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page