(data stored in ACNUC30630 zone)

EMBL: CP000113.PE101

CP000113.PE101       Location/Qualifiers
FT   CDS             complement(118762..119688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0104"
FT                   /product="aminoglycoside phosphotransferase family protein"
FT                   /note="identified by similarity to GB:AAC14693.1; match to
FT                   protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88549"
FT                   /db_xref="GOA:Q1DG36"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG36"
FT                   /protein_id="ABF88549.1"
FT                   /translation="MAHDAEQSPALTDAEAAERIHARFPALATARVVRLGEGTDHQAFE
FT                   VEGRYVFRFPKSDEAAEHLKWEARLLAWLGPRLPLPVPDYRFLAHPAADLAAGFAGYEK
FT                   LPGTPALLVEPERLDLSDLGRRLGAFLRALHALDPAEAAALGVPADDDPELEAWSAAAV
FT                   DDLRLAVEHSHMEPHRAADWEQRLRVRPTEGRGAPRLVHGDFAAEHVLVDSHGAPTGVI
FT                   DWSDACVGDPARDFAGLLHWGGAPMLTASLETYGAVSPAVLTRARWFAACRAVADIAFG
FT                   QTQGRPEYIAAGQRALTGLGKHPPFDA"
     MAHDAEQSPA LTDAEAAERI HARFPALATA RVVRLGEGTD HQAFEVEGRY VFRFPKSDEA        60
     AEHLKWEARL LAWLGPRLPL PVPDYRFLAH PAADLAAGFA GYEKLPGTPA LLVEPERLDL       120
     SDLGRRLGAF LRALHALDPA EAAALGVPAD DDPELEAWSA AAVDDLRLAV EHSHMEPHRA       180
     ADWEQRLRVR PTEGRGAPRL VHGDFAAEHV LVDSHGAPTG VIDWSDACVG DPARDFAGLL       240
     HWGGAPMLTA SLETYGAVSP AVLTRARWFA ACRAVADIAF GQTQGRPEYI AAGQRALTGL       300
     GKHPPFDA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page