(data stored in ACNUC30630 zone)

EMBL: CP000113.PE105

CP000113.PE105       Location/Qualifiers
FT   CDS             125263..126480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0108"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90302"
FT                   /db_xref="GOA:Q1DG32"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG32"
FT                   /protein_id="ABF90302.1"
FT                   /translation="MAIWDTLRLAFGTFRSNLLRSFLTLLGIVIGATTVVSMMGLIEGL
FT                   RIQVNESMSELGSDCFQVQRLPFGGNLSLAELARRPRLNEGDLEAIRLQPSVLLAAAED
FT                   SKGGQKVSTQQRESRPNVVIWAGTPEYFQTNSVVVEFGRPFTDAEYLDGRRVAVIGQDL
FT                   ADTLFPGVQPLGQNIRILGRSFQVIGTLKRRGSFMGGGSQDNQVMMPLSVYKALFGVRN
FT                   YRVSVQAQSAEVLQRAQDEVTLLMRRRHNLKPLEEDDFFVFSNESATEMFNNISKVISA
FT                   ASFGVCMLSLLVGGIGILNIMLVAVTERTREIGIRKALGAKRRRILAQFAIEAVVLSLV
FT                   GGALGVGLGMGLAQLAKWMVGLPAQVPAWAVMLSLAMSSGVGLLFGIYPAARAAKLDPV
FT                   EAMRTD"
     MAIWDTLRLA FGTFRSNLLR SFLTLLGIVI GATTVVSMMG LIEGLRIQVN ESMSELGSDC        60
     FQVQRLPFGG NLSLAELARR PRLNEGDLEA IRLQPSVLLA AAEDSKGGQK VSTQQRESRP       120
     NVVIWAGTPE YFQTNSVVVE FGRPFTDAEY LDGRRVAVIG QDLADTLFPG VQPLGQNIRI       180
     LGRSFQVIGT LKRRGSFMGG GSQDNQVMMP LSVYKALFGV RNYRVSVQAQ SAEVLQRAQD       240
     EVTLLMRRRH NLKPLEEDDF FVFSNESATE MFNNISKVIS AASFGVCMLS LLVGGIGILN       300
     IMLVAVTERT REIGIRKALG AKRRRILAQF AIEAVVLSLV GGALGVGLGM GLAQLAKWMV       360
     GLPAQVPAWA VMLSLAMSSG VGLLFGIYPA ARAAKLDPVE AMRTD                       405
//

If you have problems or comments...

PBIL Back to PBIL home page