(data stored in ACNUC30630 zone)

EMBL: CP000113.PE11

CP000113.PE11        Location/Qualifiers
FT   CDS             complement(14066..14845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87511"
FT                   /db_xref="GOA:Q1DGC6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC6"
FT                   /protein_id="ABF87511.1"
FT                   /translation="MPEPTLPEPGPDETLDSIGTAGVRVLQRRTGYRFTLDAVLLAHFA
FT                   ATERVDESGRMLELGAGSGVVSFLLVKQFGRGPVDALEFQPAVHARLMRAVALNACEAH
FT                   VTPLLGDLRRIREHVSGGQYAHVVSNPPFRLADAGVRSPDDERAVSKSEVACDAPSVVA
FT                   AARYALMPGGGVSLVYPAARVAEVLGLLTQAKLHPTVLRFVHARVGAPATRFLVHALRD
FT                   RDRGLAVRPPLIVHGEGPGGYSAEVAALMDPPLAESR"
     MPEPTLPEPG PDETLDSIGT AGVRVLQRRT GYRFTLDAVL LAHFAATERV DESGRMLELG        60
     AGSGVVSFLL VKQFGRGPVD ALEFQPAVHA RLMRAVALNA CEAHVTPLLG DLRRIREHVS       120
     GGQYAHVVSN PPFRLADAGV RSPDDERAVS KSEVACDAPS VVAAARYALM PGGGVSLVYP       180
     AARVAEVLGL LTQAKLHPTV LRFVHARVGA PATRFLVHAL RDRDRGLAVR PPLIVHGEGP       240
     GGYSAEVAAL MDPPLAESR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page