(data stored in ACNUC30630 zone)

EMBL: CP000113.PE114

CP000113.PE114       Location/Qualifiers
FT   CDS             complement(136328..139102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0117"
FT                   /product="serine/threonine kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P33973; match to
FT                   protein family HMM PF00069; match to protein family HMM
FT                   PF00515; match to protein family HMM PF07719; match to
FT                   protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90109"
FT                   /db_xref="GOA:Q1DG23"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG23"
FT                   /protein_id="ABF90109.1"
FT                   /translation="MTPGASAMSMRDSGRGRAGTGNREGDAFGTGPGSRRDDAPPVPQV
FT                   GRYFLLKRLGQGGMGVVYAAYDPDLDRKVALKLLHADSRTDSEEARARLLREAQAMARV
FT                   SHPNVIPIFDVDVWGDRVFLAMELVDGGTLASWVKEGQRSWREILESFLAAGRGLQAAH
FT                   EAGLVHRDFKPANVLVNKAGRVFVTDFGLARPVGTLPKEEPLSEDAEALIPSERRMLDT
FT                   PLTEAGLIIGTPSYMSPEQFRGDDLDPRSDQFSFCVALYWALYRQRPFEPAKMEAYASS
FT                   RKPQAQPVVEATEPLNVTAPLEREAPKPLPPPVLIQEPPRDVKVPAWVKQAMMRGLSLD
FT                   PAARFASMEALLGALSQEHRFTKRRRWVAGASTVAAGVALVGGVLYQQSQVCAAAGARM
FT                   DDVWSPAARQQVEAAFLATGKPFAQELAGKVSQVLDGYASAWKQQSTEACEATHVHGVQ
FT                   TEELLTRRTVCLARRHKDVRATVALLSSADASLVEKSVDAVHALPSLHECEDEESLAEQ
FT                   QRLPSDAAKRADIEKLEEQLAGVKALVDAGRYPKALETARALEAPVLATGHLPLTAELR
FT                   FHLGWLQEQNGQSPEASKQLFHAVRDAEAGRADRLKVAILNKLLYVEDGQQHFTQASDW
FT                   GELAHATLQRLGGEPVLEADVRMNQANLAVSQERFEDARTLLEQAKALQAHALPLGHPK
FT                   RARTTFLLGGVMLDLGKPEEAVKLLEEALTLTEAAVGPWHPDMAQRHGMLSLTLRELKQ
FT                   DAKALAHAQAAAQVRKATQGETSVLYAETLDEVGMCLHAMKRYDEALKAYEEALVIKRA
FT                   ALPADDERLQYSYDGVGQALLELGKANESVAPLRQAVSFASAPPDVLAESGFALARALW
FT                   MTQQPPAARGEAAQARARFTEAGLDARVADVDAWLSTLPPEPAPRPARRKPRR"
     MTPGASAMSM RDSGRGRAGT GNREGDAFGT GPGSRRDDAP PVPQVGRYFL LKRLGQGGMG        60
     VVYAAYDPDL DRKVALKLLH ADSRTDSEEA RARLLREAQA MARVSHPNVI PIFDVDVWGD       120
     RVFLAMELVD GGTLASWVKE GQRSWREILE SFLAAGRGLQ AAHEAGLVHR DFKPANVLVN       180
     KAGRVFVTDF GLARPVGTLP KEEPLSEDAE ALIPSERRML DTPLTEAGLI IGTPSYMSPE       240
     QFRGDDLDPR SDQFSFCVAL YWALYRQRPF EPAKMEAYAS SRKPQAQPVV EATEPLNVTA       300
     PLEREAPKPL PPPVLIQEPP RDVKVPAWVK QAMMRGLSLD PAARFASMEA LLGALSQEHR       360
     FTKRRRWVAG ASTVAAGVAL VGGVLYQQSQ VCAAAGARMD DVWSPAARQQ VEAAFLATGK       420
     PFAQELAGKV SQVLDGYASA WKQQSTEACE ATHVHGVQTE ELLTRRTVCL ARRHKDVRAT       480
     VALLSSADAS LVEKSVDAVH ALPSLHECED EESLAEQQRL PSDAAKRADI EKLEEQLAGV       540
     KALVDAGRYP KALETARALE APVLATGHLP LTAELRFHLG WLQEQNGQSP EASKQLFHAV       600
     RDAEAGRADR LKVAILNKLL YVEDGQQHFT QASDWGELAH ATLQRLGGEP VLEADVRMNQ       660
     ANLAVSQERF EDARTLLEQA KALQAHALPL GHPKRARTTF LLGGVMLDLG KPEEAVKLLE       720
     EALTLTEAAV GPWHPDMAQR HGMLSLTLRE LKQDAKALAH AQAAAQVRKA TQGETSVLYA       780
     ETLDEVGMCL HAMKRYDEAL KAYEEALVIK RAALPADDER LQYSYDGVGQ ALLELGKANE       840
     SVAPLRQAVS FASAPPDVLA ESGFALARAL WMTQQPPAAR GEAAQARARF TEAGLDARVA       900
     DVDAWLSTLP PEPAPRPARR KPRR                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page