(data stored in ACNUC30630 zone)

EMBL: CP000113.PE130

CP000113.PE130       Location/Qualifiers
FT   CDS             complement(155197..155292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0132"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG07"
FT                   /protein_id="ABF90001.1"
FT                   /translation="MVHDVFWLRVLAIALPPTVKAAHMATTDIPL"
     MVHDVFWLRV LAIALPPTVK AAHMATTDIP L                                       31
//

If you have problems or comments...

PBIL Back to PBIL home page