(data stored in ACNUC30630 zone)

EMBL: CP000113.PE136

CP000113.PE136       Location/Qualifiers
FT   CDS             162330..163220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8ZN39"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90905"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG01"
FT                   /protein_id="ABF90905.1"
FT                   /translation="MKWRWLLGGALALGLLAALAVFGRALRHSEAYFHYPRPKAERPAD
FT                   FAEAKDVSLQTSDGLTLRGWYVPSRNRAAVVLAHGLSQTRADLLPEARILRAAGYGVLL
FT                   FDLRAHGESEGGFSTWGDLERRDVRAALDFVRAQPDVDPERVGALGFSIGSAAVAEVAA
FT                   EDPAVRAVVLLSPFNTLWLAAAYDFRRFGFVSQSGALVPFWRRGIALEEVRTIDAVERI
FT                   RPRPLLIVMGTEESGQPLADELFAKVREYAQTWRIQGAGHGNFSATEPEAYPRRLTDFL
FT                   NAALLARGTSATDAR"
     MKWRWLLGGA LALGLLAALA VFGRALRHSE AYFHYPRPKA ERPADFAEAK DVSLQTSDGL        60
     TLRGWYVPSR NRAAVVLAHG LSQTRADLLP EARILRAAGY GVLLFDLRAH GESEGGFSTW       120
     GDLERRDVRA ALDFVRAQPD VDPERVGALG FSIGSAAVAE VAAEDPAVRA VVLLSPFNTL       180
     WLAAAYDFRR FGFVSQSGAL VPFWRRGIAL EEVRTIDAVE RIRPRPLLIV MGTEESGQPL       240
     ADELFAKVRE YAQTWRIQGA GHGNFSATEP EAYPRRLTDF LNAALLARGT SATDAR           296
//

If you have problems or comments...

PBIL Back to PBIL home page