(data stored in ACNUC30630 zone)

EMBL: CP000113.PE143

CP000113.PE143       Location/Qualifiers
FT   CDS             complement(178112..181291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86669"
FT                   /db_xref="GOA:Q1DFZ4"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ4"
FT                   /protein_id="ABF86669.1"
FT                   /translation="MRKQPVVMVALGGLALALAVALVHAQDDSSARPPPPTAQHGPSLR
FT                   KLDAPTPPPKGNHSLRGRVLDPWRRPVAGIQVSATREMPGESLSALPCDTRAPDLSLSS
FT                   GDCIGVPEEQVRGLVEVGHGGAPVVAQAVTSAEGTFRLEGLPEGTVALWGIGEHHATLA
FT                   LDVSTGAQDVTLVLAPGLFLPGRVIVESGASLPGARVTLFHQEHSRFFDARTGADGRFA
FT                   FGPLPPGDYTVVATSDGLLTDSLQNVEMEDLNPIVLHLPRRLSGRVLAQDTPVAGAEVH
FT                   VAYTSSVTVTDDQGRFSFEPLSPGDYEVRAEHQGAYGFAMVTLTEEDGDADTTVHLGTL
FT                   IYLEGTVRDESGRPIPEAQVGAGAARGRAPPVDYATTMADGRFRLGPLRREPYIFNVLA
FT                   SGYLGTLRDEVAAPGLRLDFTLARAHLIRGTVIDAQGTPVPDVDIDLDRESLPDTETDL
FT                   QRVDATTSDEHGRFELAVPHPRRYEIVFISQGHLEARVTADAPGPELRVVMEATARVEG
FT                   TVTSAQGLPVHHMAIHLEDDSDTGNSHTVESDEEGRFSITGVLPGTYRLHAGTNTHPAT
FT                   RAASRTVTVHGSEVVNASLRLETGAPVSGIVVDERGRPVANATVEGQSLSGRRSDLPPS
FT                   VTTSDDEGHFTLHHLAEGECSLRAAKGRYVLEATEPRAPGASHPAVLAQSGARNVRLVL
FT                   RSQGNVHGRVVRANGTPITRFTINQEPFRDPEGSFRFDAPVVGTQRLTFEAPGLTRAVR
FT                   EVQVPAAEDLDLGQVRLEAGRNVRGRVVDAATSKPIEDAIVEVHLPGEGGAFEEVTALA
FT                   VDVSQRDGTFAFPLLEARPLDVLVQTNQGHPILRHRIGTGDETLELQVYPGAQVEGTLN
FT                   DRDGKPAEAIVQLVAEDRDYSASVDEGLGAFQARNVPAGTYTLSASMGQNAEGRSVAFL
FT                   PQRVKVPPMGKVTFAFTEATGGGTMRLGIRMPPVKPDVGIYKALLSGTLPPTVSGRELR
FT                   TRARFGDIRASTKSLEGVLVYEQLPAGAYTFIVLLEEGKPARFTVHREELFLAEGETLE
FT                   RDVQVTPRPLP"
     MRKQPVVMVA LGGLALALAV ALVHAQDDSS ARPPPPTAQH GPSLRKLDAP TPPPKGNHSL        60
     RGRVLDPWRR PVAGIQVSAT REMPGESLSA LPCDTRAPDL SLSSGDCIGV PEEQVRGLVE       120
     VGHGGAPVVA QAVTSAEGTF RLEGLPEGTV ALWGIGEHHA TLALDVSTGA QDVTLVLAPG       180
     LFLPGRVIVE SGASLPGARV TLFHQEHSRF FDARTGADGR FAFGPLPPGD YTVVATSDGL       240
     LTDSLQNVEM EDLNPIVLHL PRRLSGRVLA QDTPVAGAEV HVAYTSSVTV TDDQGRFSFE       300
     PLSPGDYEVR AEHQGAYGFA MVTLTEEDGD ADTTVHLGTL IYLEGTVRDE SGRPIPEAQV       360
     GAGAARGRAP PVDYATTMAD GRFRLGPLRR EPYIFNVLAS GYLGTLRDEV AAPGLRLDFT       420
     LARAHLIRGT VIDAQGTPVP DVDIDLDRES LPDTETDLQR VDATTSDEHG RFELAVPHPR       480
     RYEIVFISQG HLEARVTADA PGPELRVVME ATARVEGTVT SAQGLPVHHM AIHLEDDSDT       540
     GNSHTVESDE EGRFSITGVL PGTYRLHAGT NTHPATRAAS RTVTVHGSEV VNASLRLETG       600
     APVSGIVVDE RGRPVANATV EGQSLSGRRS DLPPSVTTSD DEGHFTLHHL AEGECSLRAA       660
     KGRYVLEATE PRAPGASHPA VLAQSGARNV RLVLRSQGNV HGRVVRANGT PITRFTINQE       720
     PFRDPEGSFR FDAPVVGTQR LTFEAPGLTR AVREVQVPAA EDLDLGQVRL EAGRNVRGRV       780
     VDAATSKPIE DAIVEVHLPG EGGAFEEVTA LAVDVSQRDG TFAFPLLEAR PLDVLVQTNQ       840
     GHPILRHRIG TGDETLELQV YPGAQVEGTL NDRDGKPAEA IVQLVAEDRD YSASVDEGLG       900
     AFQARNVPAG TYTLSASMGQ NAEGRSVAFL PQRVKVPPMG KVTFAFTEAT GGGTMRLGIR       960
     MPPVKPDVGI YKALLSGTLP PTVSGRELRT RARFGDIRAS TKSLEGVLVY EQLPAGAYTF      1020
     IVLLEEGKPA RFTVHREELF LAEGETLERD VQVTPRPLP                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page