(data stored in ACNUC30630 zone)

EMBL: CP000113.PE145

CP000113.PE145       Location/Qualifiers
FT   CDS             complement(182235..185459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM05750.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87684"
FT                   /db_xref="GOA:Q1DFZ2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFZ2"
FT                   /protein_id="ABF87684.1"
FT                   /translation="MKPGLRIDALRVLGFGRFSGLTRDLGPGLHLLYGPNEAGKSTLLA
FT                   FLRSMLFGFEKRGQPERYEPAHGGAFGGELTLTTHAGPLLVRRIASRRSSEGELSVRDA
FT                   EGKELSKESLESALAHVSRELFFDVFAFRLDELAGFERLTEQRGASEALVAASMRGARR
FT                   LPEVMDQLRKRIEKIYKPNGVTPSLNVTLKALEDVQVRLRQEGDRPARYFAEKERLGAL
FT                   VEEQRTLEAALLETGTGLERLTRLEAALGDVAALAQARAELATLPALETFPEAGESRLE
FT                   DGLHRRRSYRAEGARLAERLATVEAGLERLSAPSGVRGREEALSQALAAYTEGAALLRA
FT                   LPSRRAALAEKQRQVELALRELGLPVDGPGLLALDLSVSVRVTLEELALRLGAAEVAHR
FT                   EAEGAWARAVSERERLDGALARVDAELSTLPEERASRIRQQQAGLGRLRTVRAEVERLS
FT                   EQRAELHRQFESVRTQGEPQATAAVLPTWWVPAVAAVVVALAVTAWLLAGNVVGALCLV
FT                   GGLLLTGVLELARRRVETARDADVEAQRARQRWRQQEEERLRAALMGLSAREELLHREL
FT                   LSAASEAGLNLVATAADMAAREAVLADALERAGRREQLERERETLHAEHTAARREEHRA
FT                   SEAVGEAESRQEQLGTELTALLSERHFPPTLAASAALTLWRDAAALRQRLLDVGAEEAA
FT                   LTVDAQVCALVTSRLWAEAVVAELIPGATEARELDAGVMEPLASRVAAALEAERAQSLE
FT                   RRTLEERRHELRAEKARLDGLCHDEEAALATLLAEGGSPDEETFRRRAAQARRYVELTG
FT                   RTRELSHRIEARTGLSETLARQALIDVGGEQGLRVELESLRDRQAEAQDRLKAVLTERG
FT                   ALSHQLEQWENDDALAKLRIVEESLRARAAELAKQYAADRLTLALLARARRRFEEEQQP
FT                   RVVQLASEHFATLTQGRYQRVFIPTGEERELRVGDGQRDWSAAQLSRGTREQLYLAFRL
FT                   AVVRDFGETRGALPLIVDDVLVNFDPERARGAIHLLAKLSEHQQVIAFTCHPWLRDAFA
FT                   AEGARVQALDASTSEPPAPVSVLKTG"
     MKPGLRIDAL RVLGFGRFSG LTRDLGPGLH LLYGPNEAGK STLLAFLRSM LFGFEKRGQP        60
     ERYEPAHGGA FGGELTLTTH AGPLLVRRIA SRRSSEGELS VRDAEGKELS KESLESALAH       120
     VSRELFFDVF AFRLDELAGF ERLTEQRGAS EALVAASMRG ARRLPEVMDQ LRKRIEKIYK       180
     PNGVTPSLNV TLKALEDVQV RLRQEGDRPA RYFAEKERLG ALVEEQRTLE AALLETGTGL       240
     ERLTRLEAAL GDVAALAQAR AELATLPALE TFPEAGESRL EDGLHRRRSY RAEGARLAER       300
     LATVEAGLER LSAPSGVRGR EEALSQALAA YTEGAALLRA LPSRRAALAE KQRQVELALR       360
     ELGLPVDGPG LLALDLSVSV RVTLEELALR LGAAEVAHRE AEGAWARAVS ERERLDGALA       420
     RVDAELSTLP EERASRIRQQ QAGLGRLRTV RAEVERLSEQ RAELHRQFES VRTQGEPQAT       480
     AAVLPTWWVP AVAAVVVALA VTAWLLAGNV VGALCLVGGL LLTGVLELAR RRVETARDAD       540
     VEAQRARQRW RQQEEERLRA ALMGLSAREE LLHRELLSAA SEAGLNLVAT AADMAAREAV       600
     LADALERAGR REQLERERET LHAEHTAARR EEHRASEAVG EAESRQEQLG TELTALLSER       660
     HFPPTLAASA ALTLWRDAAA LRQRLLDVGA EEAALTVDAQ VCALVTSRLW AEAVVAELIP       720
     GATEARELDA GVMEPLASRV AAALEAERAQ SLERRTLEER RHELRAEKAR LDGLCHDEEA       780
     ALATLLAEGG SPDEETFRRR AAQARRYVEL TGRTRELSHR IEARTGLSET LARQALIDVG       840
     GEQGLRVELE SLRDRQAEAQ DRLKAVLTER GALSHQLEQW ENDDALAKLR IVEESLRARA       900
     AELAKQYAAD RLTLALLARA RRRFEEEQQP RVVQLASEHF ATLTQGRYQR VFIPTGEERE       960
     LRVGDGQRDW SAAQLSRGTR EQLYLAFRLA VVRDFGETRG ALPLIVDDVL VNFDPERARG      1020
     AIHLLAKLSE HQQVIAFTCH PWLRDAFAAE GARVQALDAS TSEPPAPVSV LKTG            1074
//

If you have problems or comments...

PBIL Back to PBIL home page