(data stored in ACNUC30630 zone)

EMBL: CP000113.PE149

CP000113.PE149       Location/Qualifiers
FT   CDS             complement(188295..189032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89458"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY8"
FT                   /protein_id="ABF89458.1"
FT                   /translation="MSGGALYQESLRALRRLGLPEVSERDVLAALEAAQPGPLSLFYEA
FT                   GAEAGLPREALMARGAGLFLSFSAGNLADDLIDGECTYHDPPIRVGPCVQFILQNLAFA
FT                   TLCGAPAQLPGTVLEEAVRTLAVAAGPQALEVRASDWTAPLFRQVAEGIAGQQWAAYLR
FT                   VLWAGTVLEPRAAAAGRALGVAAHVAEDIRTRDVRFTSMPGADRHAVVAWARAAAQALR
FT                   RLDLRCLDAALRRIEPMLPEGES"
     MSGGALYQES LRALRRLGLP EVSERDVLAA LEAAQPGPLS LFYEAGAEAG LPREALMARG        60
     AGLFLSFSAG NLADDLIDGE CTYHDPPIRV GPCVQFILQN LAFATLCGAP AQLPGTVLEE       120
     AVRTLAVAAG PQALEVRASD WTAPLFRQVA EGIAGQQWAA YLRVLWAGTV LEPRAAAAGR       180
     ALGVAAHVAE DIRTRDVRFT SMPGADRHAV VAWARAAAQA LRRLDLRCLD AALRRIEPML       240
     PEGES                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page