(data stored in ACNUC30630 zone)

EMBL: CP000113.PE152

CP000113.PE152       Location/Qualifiers
FT   CDS             190980..191867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0155"
FT                   /product="transporter, EamA family"
FT                   /note="identified by similarity to SP:P36545; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88367"
FT                   /db_xref="GOA:Q1DFY5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFY5"
FT                   /protein_id="ABF88367.1"
FT                   /translation="MSRVLTKPGPVTVAVLTLLVAMASIQTGASLAKQVFPVLGAAGAT
FT                   ALRVFFAALILAAVFRPWRQRLTRKDLRAVAIYGAALGGMNLTFYLALERIPLGIAVAI
FT                   EFTGPLALAIFSTRRALDFVWALLAVAGILLILPLSETSRSLDWMGVFWALVAATCWAL
FT                   YILFGQRAGGTVHGGTAASLGMCVAALLVMPFGVAHAGMKLLDVSLLPIILCVAVLSSA
FT                   LPYSLEMYALKALPTRTFGILMSLEPALAAVSGLLLLDERLSLVQWAAIGCIILASVGS
FT                   SATSRKPVEAVAAS"
     MSRVLTKPGP VTVAVLTLLV AMASIQTGAS LAKQVFPVLG AAGATALRVF FAALILAAVF        60
     RPWRQRLTRK DLRAVAIYGA ALGGMNLTFY LALERIPLGI AVAIEFTGPL ALAIFSTRRA       120
     LDFVWALLAV AGILLILPLS ETSRSLDWMG VFWALVAATC WALYILFGQR AGGTVHGGTA       180
     ASLGMCVAAL LVMPFGVAHA GMKLLDVSLL PIILCVAVLS SALPYSLEMY ALKALPTRTF       240
     GILMSLEPAL AAVSGLLLLD ERLSLVQWAA IGCIILASVG SSATSRKPVE AVAAS            295
//

If you have problems or comments...

PBIL Back to PBIL home page