(data stored in ACNUC30630 zone)

EMBL: CP000113.PE158

CP000113.PE158       Location/Qualifiers
FT   CDS             complement(195530..196189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO57075.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86553"
FT                   /db_xref="GOA:Q1DFX9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX9"
FT                   /protein_id="ABF86553.1"
FT                   /translation="MQAPERRRPQPWLIRVTHWLNVPLLLIMAASGLQILVAYPMLGPQ
FT                   GRPYGWYPYQGIPPPEWMRLGNWLAGARHWHFAFAWFLILNGVAYVLYLALSGEWRRRL
FT                   FLPRRDTRNALDTLAFYLRVRKHAPAQGLYNGLQRLAYTGTLALGLLAVLSGLVLYKPV
FT                   QFGALTSLLGGYDAARAIHLVILALLALFTVGHITLVLLHPRSLAEMVTGGRKPDA"
     MQAPERRRPQ PWLIRVTHWL NVPLLLIMAA SGLQILVAYP MLGPQGRPYG WYPYQGIPPP        60
     EWMRLGNWLA GARHWHFAFA WFLILNGVAY VLYLALSGEW RRRLFLPRRD TRNALDTLAF       120
     YLRVRKHAPA QGLYNGLQRL AYTGTLALGL LAVLSGLVLY KPVQFGALTS LLGGYDAARA       180
     IHLVILALLA LFTVGHITLV LLHPRSLAEM VTGGRKPDA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page