(data stored in ACNUC30630 zone)

EMBL: CP000113.PE16

CP000113.PE16        Location/Qualifiers
FT   CDS             22471..24672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87696"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC1"
FT                   /protein_id="ABF87696.1"
FT                   /translation="MAHATQASRYSGIVLALMLGWGAAACRDTPSLSGAEGRLRLSARR
FT                   VDFPHAYPGTRREAEVRVVNGGRAPLDVTWTDVTAPFSLEAALPVRVLAGEVPVRLRFA
FT                   PEAEGTYEVILTGTASDGGQVQLVLAGEAKPVPECFTPVTCAAATFDLVTERCVESVLP
FT                   DGTACEPGNACITGATCQAGRCRGEERACDDGNACTTDVCHVLDGCQSVPAPPCPAAGP
FT                   CQVGTCDPRMGCATAPAPDGTLCGAAQGTCEDADVCLDGACVKRDLPEGFLCEAASPCQ
FT                   VSGHCRGGVCARPAAQPLKVDWEHDARAGEEQLQDLLVGPEGDVTLSGFYGTPVLDAAG
FT                   KGPLVRASKPARRCMLWNDRILCMDMPMDGTVSLLERDTGTPRWTFTLADARPDFRDRT
FT                   QTLFLARLAVMAPDRLAALFEAYPTDQRRDTACRMYFLVVLDAFGHMVSARELTDPMLA
FT                   ECNHPHPYGLASDAVGDLYVAFAPTLNTGAPLASGTPSLLMAFSSDGVPRWRRTEPLRA
FT                   GELAVVNGLLLPEWGFQALSTRDGTPVGEHLAQQLGRAVATRDVVVPSASGTTVNADVD
FT                   SLSFTPAATQLKGFRLPDLEPAWLYSLKEGQHLTSKELRLATWPRGAGLPPETLVLTHA
FT                   VAADNQRLLVGVRARDGAEAFQCPLDYAPRTVPQLMELGPGALYLMDGALSCGECDPPF
FT                   ANSQPRFMRFPMPGLLPANAPWPGTFGGPGHGHHENAAH"
     MAHATQASRY SGIVLALMLG WGAAACRDTP SLSGAEGRLR LSARRVDFPH AYPGTRREAE        60
     VRVVNGGRAP LDVTWTDVTA PFSLEAALPV RVLAGEVPVR LRFAPEAEGT YEVILTGTAS       120
     DGGQVQLVLA GEAKPVPECF TPVTCAAATF DLVTERCVES VLPDGTACEP GNACITGATC       180
     QAGRCRGEER ACDDGNACTT DVCHVLDGCQ SVPAPPCPAA GPCQVGTCDP RMGCATAPAP       240
     DGTLCGAAQG TCEDADVCLD GACVKRDLPE GFLCEAASPC QVSGHCRGGV CARPAAQPLK       300
     VDWEHDARAG EEQLQDLLVG PEGDVTLSGF YGTPVLDAAG KGPLVRASKP ARRCMLWNDR       360
     ILCMDMPMDG TVSLLERDTG TPRWTFTLAD ARPDFRDRTQ TLFLARLAVM APDRLAALFE       420
     AYPTDQRRDT ACRMYFLVVL DAFGHMVSAR ELTDPMLAEC NHPHPYGLAS DAVGDLYVAF       480
     APTLNTGAPL ASGTPSLLMA FSSDGVPRWR RTEPLRAGEL AVVNGLLLPE WGFQALSTRD       540
     GTPVGEHLAQ QLGRAVATRD VVVPSASGTT VNADVDSLSF TPAATQLKGF RLPDLEPAWL       600
     YSLKEGQHLT SKELRLATWP RGAGLPPETL VLTHAVAADN QRLLVGVRAR DGAEAFQCPL       660
     DYAPRTVPQL MELGPGALYL MDGALSCGEC DPPFANSQPR FMRFPMPGLL PANAPWPGTF       720
     GGPGHGHHEN AAH                                                          733
//

If you have problems or comments...

PBIL Back to PBIL home page