(data stored in ACNUC30630 zone)

EMBL: CP000113.PE165

CP000113.PE165       Location/Qualifiers
FT   CDS             203476..205323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0168"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88089"
FT                   /db_xref="GOA:Q1DFX2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFX2"
FT                   /protein_id="ABF88089.1"
FT                   /translation="MTLRARLLLAQAPLALALLLVGVVAVVTLSQLGRSGPRVLQDNYR
FT                   SVLAAQEMMAQLERMDSGALFIIAGERQRGLTQQAAQRARLESQLRVQEGNVTEPAEDA
FT                   ATLRLRTSWRRYQEAYDGFLAQSSPEGAREAYFGVLEPAFQEVTGAARAILDLNQDAMV
FT                   RKSEALQRQSARVNTVMVAAVMVAFVVGLFASQSLTHRALRPVSVLSQAVRRLGEGDYA
FT                   ARAVVEGQDEIAQVGRDFNAMAEALQQYRRSSLGELLQAQAASQAAIDSLPDPVVVFGA
FT                   DGGLLNVNRAAEDVLRLSLEAGGDMLGQVVPEARAVLERVREHVLTGRGAYQPRGYEEA
FT                   VRAPLPDGDRWLLARGSPVHGESGEVVGATVILQDVTRLRRFDELKNDLVATVAHEFRT
FT                   PLTSLRMALHLVTEGVVGPVTEKQADLLFAAREDSERLQGIVDDLLDLSRIQAGQLQLE
FT                   IRRVPAEELVDAALDAQRMAAEERGVQVSKQVGLDVEPVDVDPERLGLVLGNLVGNAVK
FT                   HTPPGGEVEVHVWQESHGVRFEVRDTGEGIALEQQARIFEKFYRAPGAPAGGAGLGLSI
FT                   AKDIVQAHGGDIGVVSTPGQGSTFWFTLPRREESGPASV"
     MTLRARLLLA QAPLALALLL VGVVAVVTLS QLGRSGPRVL QDNYRSVLAA QEMMAQLERM        60
     DSGALFIIAG ERQRGLTQQA AQRARLESQL RVQEGNVTEP AEDAATLRLR TSWRRYQEAY       120
     DGFLAQSSPE GAREAYFGVL EPAFQEVTGA ARAILDLNQD AMVRKSEALQ RQSARVNTVM       180
     VAAVMVAFVV GLFASQSLTH RALRPVSVLS QAVRRLGEGD YAARAVVEGQ DEIAQVGRDF       240
     NAMAEALQQY RRSSLGELLQ AQAASQAAID SLPDPVVVFG ADGGLLNVNR AAEDVLRLSL       300
     EAGGDMLGQV VPEARAVLER VREHVLTGRG AYQPRGYEEA VRAPLPDGDR WLLARGSPVH       360
     GESGEVVGAT VILQDVTRLR RFDELKNDLV ATVAHEFRTP LTSLRMALHL VTEGVVGPVT       420
     EKQADLLFAA REDSERLQGI VDDLLDLSRI QAGQLQLEIR RVPAEELVDA ALDAQRMAAE       480
     ERGVQVSKQV GLDVEPVDVD PERLGLVLGN LVGNAVKHTP PGGEVEVHVW QESHGVRFEV       540
     RDTGEGIALE QQARIFEKFY RAPGAPAGGA GLGLSIAKDI VQAHGGDIGV VSTPGQGSTF       600
     WFTLPRREES GPASV                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page