(data stored in ACNUC30630 zone)

EMBL: CP000113.PE189

CP000113.PE189       Location/Qualifiers
FT   CDS             complement(233826..234929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89338"
FT                   /db_xref="GOA:Q1DFU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU8"
FT                   /protein_id="ABF89338.1"
FT                   /translation="MALSVQYFHREEFETRTLRALGGAACMGLVAGAVPDLHLTPEYLA
FT                   IVAAAQACVKPTGVHPLALRLALTVLPALPYFFRAPEPLPVSLAGALAAAMVAWLGHGR
FT                   EQPGQPAAVATSAAAAGLLVPLGLYVQQVLEARFLGSDGLLSALVGFLVVGLFWSIGTL
FT                   PANLRVELDAVEARGRQLQDALKGDSHTLATRALALYRQCKDVVTKMPPSTGRTELLGV
FT                   LEKMTGDSFSLAEVHFGLEAQLGSVVANDVDAQVRELRERAAATQDAVARRQLELAASS
FT                   LGEELNHLDVLARRKERLLAQLHAQVALLERARVSFIGVQGNELGAKGAQAADLARKLK
FT                   QLGEPSSSGGPDDVASVAAPNPTRVAP"
     MALSVQYFHR EEFETRTLRA LGGAACMGLV AGAVPDLHLT PEYLAIVAAA QACVKPTGVH        60
     PLALRLALTV LPALPYFFRA PEPLPVSLAG ALAAAMVAWL GHGREQPGQP AAVATSAAAA       120
     GLLVPLGLYV QQVLEARFLG SDGLLSALVG FLVVGLFWSI GTLPANLRVE LDAVEARGRQ       180
     LQDALKGDSH TLATRALALY RQCKDVVTKM PPSTGRTELL GVLEKMTGDS FSLAEVHFGL       240
     EAQLGSVVAN DVDAQVRELR ERAAATQDAV ARRQLELAAS SLGEELNHLD VLARRKERLL       300
     AQLHAQVALL ERARVSFIGV QGNELGAKGA QAADLARKLK QLGEPSSSGG PDDVASVAAP       360
     NPTRVAP                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page