(data stored in ACNUC30630 zone)

EMBL: CP000113.PE190

CP000113.PE190       Location/Qualifiers
FT   CDS             complement(234948..236216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0194"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89436"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU7"
FT                   /protein_id="ABF89436.1"
FT                   /translation="MTSKPEDGALNMAGKLSGAYVQTGPSEAFAWMELKARPAETGQRV
FT                   PVSLALVLDRSGSMNGQKLADARRAATELVQRLKPEDRLAFIDYGTDVRVQPSRRMTEE
FT                   AREELLTLISGLQDDGSTNISGALDAAANALRPHMREYRVSRAILLSDGQPTTGIVSEP
FT                   GLLDQVRQLRRDGITVSALGVGRDYQETLMRGMAEQGGGFSGFIDDSARLAEVFSRELD
FT                   QATSTVARMVELRLDVPPEVQDVEVMGMASFREGNVLKVPLYDMASAQTVRVMAKLTLN
FT                   TSRTAGALALLNARVHYVDVARDLPTETALQLTAEVTSDLDRVREYLDKEVRVHAVRAM
FT                   GTQHMVAAAEEMKRGNKAKASSLLDNARTIFGTSADALSGELADVRRSQAALAGASSAE
FT                   EAQAESRNLLKKSIKNFGQNNTY"
     MTSKPEDGAL NMAGKLSGAY VQTGPSEAFA WMELKARPAE TGQRVPVSLA LVLDRSGSMN        60
     GQKLADARRA ATELVQRLKP EDRLAFIDYG TDVRVQPSRR MTEEAREELL TLISGLQDDG       120
     STNISGALDA AANALRPHMR EYRVSRAILL SDGQPTTGIV SEPGLLDQVR QLRRDGITVS       180
     ALGVGRDYQE TLMRGMAEQG GGFSGFIDDS ARLAEVFSRE LDQATSTVAR MVELRLDVPP       240
     EVQDVEVMGM ASFREGNVLK VPLYDMASAQ TVRVMAKLTL NTSRTAGALA LLNARVHYVD       300
     VARDLPTETA LQLTAEVTSD LDRVREYLDK EVRVHAVRAM GTQHMVAAAE EMKRGNKAKA       360
     SSLLDNARTI FGTSADALSG ELADVRRSQA ALAGASSAEE AQAESRNLLK KSIKNFGQNN       420
     TY                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page