(data stored in ACNUC30630 zone)

EMBL: CP000113.PE191

CP000113.PE191       Location/Qualifiers
FT   CDS             complement(236498..239401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0195"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF01590;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90749"
FT                   /db_xref="GOA:Q1DFU6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFU6"
FT                   /protein_id="ABF90749.1"
FT                   /translation="MTLRPPARPTFSSSIMQKPHSTPDWTSNEHRYRGVIDSLREVVFQ
FT                   TDLAGTWTFLNPAWTDITGFSVEESLGRSFSDFLHPDDRERDPEPLQKLFAGEVEFVRH
FT                   EMRYLTRDGSYRWVEVFARLMHDDDGGILGTAGTLNDFTERKAADGALARRERYLTALV
FT                   DMQQRLLATQDGGDLYGPALAPLGHASGASRVYVFELHRAQDGAILSSQRAEWCAPGVK
FT                   PEIDNPDLQNVPMEPALRRWTETLSRGDVIEGLVASFPASERELLDPQGILSLLVLPLR
FT                   VRGVLTGFVGFDNTSEARRWDRLEVDLLSAAAGAISMALERRESERALRERERRFRQLA
FT                   ENASDVLYVYRREAPRGFAYVSRVAHTKLGYGPVAHYADAELWYRRVHEEDRALMEQLL
FT                   EAPEPFQGAPVVVRFLHPDGRTLWLEHVVAPVTDASGRMVAVEGLARDITERRQAEEAL
FT                   RLSEASFRALLEGVPDAAAIERDNQIVYANAALVATLGFERADQLVGRPLTEFVRDMRS
FT                   PDAVRAGALTGERRLVRRDGRTRVAEVVSLPLRFDGQPAVVSIARDVTEQRQLQARLTL
FT                   ADRLASVGTLAAGIAHEINNPLAFVLSNLGFLSDEFSRSLPPGDGAAALQARLKGEPDL
FT                   GEWQEVLQEACEGAERVRQIVRQLKTFSRPDEERVSPLDVHAVLESVAMMAANEIRHRA
FT                   QLRRDYGDIPPVMANEGKLSQVFLNLVVNAAQAIPEGAAHRHEIRLATRVDGAGRVVVE
FT                   VADTGVGIAREVIDRIFDPFFTTKPVGVGTGLGLSICHSIISGLGGDITVDSEPERGTL
FT                   FRVVLPTPETVERAKPSEPDSRQAPRAPRGRVLVVDDEPAVGRVLQRILREHQVDVACS
FT                   GRQALELLERGLVPDAVLCDVMMPDLTGRDVYEAVRREYAGLERRFVFVSGGAFTSGAR
FT                   DFLASIPNLLLEKPFDEARVRGVVEELVRQRLPAHDA"
     MTLRPPARPT FSSSIMQKPH STPDWTSNEH RYRGVIDSLR EVVFQTDLAG TWTFLNPAWT        60
     DITGFSVEES LGRSFSDFLH PDDRERDPEP LQKLFAGEVE FVRHEMRYLT RDGSYRWVEV       120
     FARLMHDDDG GILGTAGTLN DFTERKAADG ALARRERYLT ALVDMQQRLL ATQDGGDLYG       180
     PALAPLGHAS GASRVYVFEL HRAQDGAILS SQRAEWCAPG VKPEIDNPDL QNVPMEPALR       240
     RWTETLSRGD VIEGLVASFP ASERELLDPQ GILSLLVLPL RVRGVLTGFV GFDNTSEARR       300
     WDRLEVDLLS AAAGAISMAL ERRESERALR ERERRFRQLA ENASDVLYVY RREAPRGFAY       360
     VSRVAHTKLG YGPVAHYADA ELWYRRVHEE DRALMEQLLE APEPFQGAPV VVRFLHPDGR       420
     TLWLEHVVAP VTDASGRMVA VEGLARDITE RRQAEEALRL SEASFRALLE GVPDAAAIER       480
     DNQIVYANAA LVATLGFERA DQLVGRPLTE FVRDMRSPDA VRAGALTGER RLVRRDGRTR       540
     VAEVVSLPLR FDGQPAVVSI ARDVTEQRQL QARLTLADRL ASVGTLAAGI AHEINNPLAF       600
     VLSNLGFLSD EFSRSLPPGD GAAALQARLK GEPDLGEWQE VLQEACEGAE RVRQIVRQLK       660
     TFSRPDEERV SPLDVHAVLE SVAMMAANEI RHRAQLRRDY GDIPPVMANE GKLSQVFLNL       720
     VVNAAQAIPE GAAHRHEIRL ATRVDGAGRV VVEVADTGVG IAREVIDRIF DPFFTTKPVG       780
     VGTGLGLSIC HSIISGLGGD ITVDSEPERG TLFRVVLPTP ETVERAKPSE PDSRQAPRAP       840
     RGRVLVVDDE PAVGRVLQRI LREHQVDVAC SGRQALELLE RGLVPDAVLC DVMMPDLTGR       900
     DVYEAVRREY AGLERRFVFV SGGAFTSGAR DFLASIPNLL LEKPFDEARV RGVVEELVRQ       960
     RLPAHDA                                                                 967
//

If you have problems or comments...

PBIL Back to PBIL home page