(data stored in ACNUC30630 zone)

EMBL: CP000113.PE200

CP000113.PE200       Location/Qualifiers
FT   CDS             complement(249306..249956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25443.1; match to
FT                   protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87762"
FT                   /db_xref="GOA:Q1DFT7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFT7"
FT                   /protein_id="ABF87762.1"
FT                   /translation="MGPEFRRIRGGLPGPRVSDEEAASMKALAYDAVMTPLGWLGLTAA
FT                   RRKLVRGLSGHVLEVGTGTGLALPGYPDTVTAVTAIDVDEAALARAQRRRPDARLLYAS
FT                   VESLPFPTASFDAVVSSLVFCSVEAPAQALTEIFRVLRPGGALRMLEHVRAPSPALATV
FT                   QDLLTPAWMRVSGGCRLDRETFDLVRRAGFDIERRVQRLQGVSELIIARRPAS"
     MGPEFRRIRG GLPGPRVSDE EAASMKALAY DAVMTPLGWL GLTAARRKLV RGLSGHVLEV        60
     GTGTGLALPG YPDTVTAVTA IDVDEAALAR AQRRRPDARL LYASVESLPF PTASFDAVVS       120
     SLVFCSVEAP AQALTEIFRV LRPGGALRML EHVRAPSPAL ATVQDLLTPA WMRVSGGCRL       180
     DRETFDLVRR AGFDIERRVQ RLQGVSELII ARRPAS                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page