(data stored in ACNUC30630 zone)

EMBL: CP000113.PE225

CP000113.PE225       Location/Qualifiers
FT   CDS             complement(277754..279280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0229"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88790"
FT                   /db_xref="GOA:Q1DFR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFR2"
FT                   /protein_id="ABF88790.1"
FT                   /translation="MGEPHPATVLNVNDDDANRYLVNRLLSLAGYNVVEAATGMGALLM
FT                   AQQHRPDVIILDVKLPDISGYEVCERLRANPQTAAMAVLHTSATFVTSDKKVRGLDGGA
FT                   DAYLTQPFEGAELIATVKSLLRLRHAEQVARQRANALAEMDRRKDEFLAMLGHELRNPL
FT                   AAIMTAIGILERRPTSDDKEARMRGIIQRQTNHLARLVDDLLDVSRITRDKVELRPGSV
FT                   DLVPVLRQVLQIVQPMADSRGLGLDVSLPSGPLWLQADATRLEQVFTNLLDNAIKYTDA
FT                   GGVHLRAEQEGVGGAAQAVVRVKDSGIGIPPEVLPHIFELFAQADTSLERSRGGLGIGL
FT                   TLVRKLIQLHGGEVTARSNGPGHGSEFVVKLPLDHTMGKSAPARDAVDLRRGRRVLVVE
FT                   DNSDARQAMRDLLELWGHQVAVAPDGLQGVALAMAQPPELALVDIGLPGLDGYRVAQTL
FT                   RAQVGNGIRLVAMTGYGSPHGRDQALRAGFDRHLVKPVKPDELDRILSEL"
     MGEPHPATVL NVNDDDANRY LVNRLLSLAG YNVVEAATGM GALLMAQQHR PDVIILDVKL        60
     PDISGYEVCE RLRANPQTAA MAVLHTSATF VTSDKKVRGL DGGADAYLTQ PFEGAELIAT       120
     VKSLLRLRHA EQVARQRANA LAEMDRRKDE FLAMLGHELR NPLAAIMTAI GILERRPTSD       180
     DKEARMRGII QRQTNHLARL VDDLLDVSRI TRDKVELRPG SVDLVPVLRQ VLQIVQPMAD       240
     SRGLGLDVSL PSGPLWLQAD ATRLEQVFTN LLDNAIKYTD AGGVHLRAEQ EGVGGAAQAV       300
     VRVKDSGIGI PPEVLPHIFE LFAQADTSLE RSRGGLGIGL TLVRKLIQLH GGEVTARSNG       360
     PGHGSEFVVK LPLDHTMGKS APARDAVDLR RGRRVLVVED NSDARQAMRD LLELWGHQVA       420
     VAPDGLQGVA LAMAQPPELA LVDIGLPGLD GYRVAQTLRA QVGNGIRLVA MTGYGSPHGR       480
     DQALRAGFDR HLVKPVKPDE LDRILSEL                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page