(data stored in ACNUC30630 zone)

EMBL: CP000113.PE23

CP000113.PE23        Location/Qualifiers
FT   CDS             33951..34370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGB4"
FT                   /protein_id="ABF87179.1"
FT                   /translation="MKCRALLLALVMLPGCALFQRPFRPEHASKEEAAKLPYPLWLPSE
FT                   GRVRVPANMSAAIQLAMDDMLPRDVKPPRDATPDDVCLHRRDSYDVEAAPLNDEVVLVR
FT                   FLVKEGACRSEGATATEAATYAIDIRGWRILAVQR"
     MKCRALLLAL VMLPGCALFQ RPFRPEHASK EEAAKLPYPL WLPSEGRVRV PANMSAAIQL        60
     AMDDMLPRDV KPPRDATPDD VCLHRRDSYD VEAAPLNDEV VLVRFLVKEG ACRSEGATAT       120
     EAATYAIDIR GWRILAVQR                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page