(data stored in ACNUC30630 zone)

EMBL: CP000113.PE234

CP000113.PE234       Location/Qualifiers
FT   CDS             complement(288955..289587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G75575"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91116"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFQ3"
FT                   /protein_id="ABF91116.1"
FT                   /translation="MANESMHTDANQPGGLQLPEEGAGPLLQRDYWAVIRDCRVSPEEL
FT                   MRWVAVRFAEFAPSELCVFERSHPERGGQPLALDDELTVKIQGAGTFAVRVIHQDAQSF
FT                   TLGTLHGHPEAGRITFGAYRNARGDVIFHIRSRARSGSTFHYLGFVTAGDAMQTNTWTE
FT                   FVLRAALTAGDGVHGVIHADTTELEDEPPGGDTVHGPTFLARGDGRQ"
     MANESMHTDA NQPGGLQLPE EGAGPLLQRD YWAVIRDCRV SPEELMRWVA VRFAEFAPSE        60
     LCVFERSHPE RGGQPLALDD ELTVKIQGAG TFAVRVIHQD AQSFTLGTLH GHPEAGRITF       120
     GAYRNARGDV IFHIRSRARS GSTFHYLGFV TAGDAMQTNT WTEFVLRAAL TAGDGVHGVI       180
     HADTTELEDE PPGGDTVHGP TFLARGDGRQ                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page