(data stored in ACNUC30630 zone)

EMBL: CP000113.PE244

CP000113.PE244       Location/Qualifiers
FT   CDS             297199..297951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0249"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02405;
FT                   match to protein family HMM TIGR00056"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90281"
FT                   /db_xref="GOA:Q1DFP3"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP3"
FT                   /protein_id="ABF90281.1"
FT                   /translation="MDRAKERLESLGALSRMTGQVFSRAVRPPFDWRGLVYHTESLGVR
FT                   SLPIALLTAMFAGLVISLQFGYFLSRFGVQYTVGRVVILTLFRELAPVLTALTVGARIG
FT                   SGIAAELGAMTVTEQVDAIRALGADPLRKLVVPRVLACLIVLPVLTVFADVVGLVAGAL
FT                   VVNIQYAITLNLFFQGALDAVLMPDFASGVFKGAVFGLIIGLVGCFRGLTVEGGTEGVG
FT                   RATTQTVATTSVSVCLADFFITQLTLSL"
     MDRAKERLES LGALSRMTGQ VFSRAVRPPF DWRGLVYHTE SLGVRSLPIA LLTAMFAGLV        60
     ISLQFGYFLS RFGVQYTVGR VVILTLFREL APVLTALTVG ARIGSGIAAE LGAMTVTEQV       120
     DAIRALGADP LRKLVVPRVL ACLIVLPVLT VFADVVGLVA GALVVNIQYA ITLNLFFQGA       180
     LDAVLMPDFA SGVFKGAVFG LIIGLVGCFR GLTVEGGTEG VGRATTQTVA TTSVSVCLAD       240
     FFITQLTLSL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page