(data stored in ACNUC30630 zone)

EMBL: CP000113.PE247

CP000113.PE247       Location/Qualifiers
FT   CDS             complement(299978..300706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0252"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88870"
FT                   /db_xref="InterPro:IPR011750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFP0"
FT                   /protein_id="ABF88870.1"
FT                   /translation="MRFFEVLEDEATRNTGRIDGVSPWCIPSIDCTVCGGYGGLGEAYP
FT                   TVDLARFAHRALLEEPRSQQALSLEAYRHLCEQLRPWVPPAAPLEPGTQLGPVVGKAKG
FT                   RFGDFYFQAPWAPWIRISALEKLHAAGVRGLHGAPGDLGYRGQPAPPLHCLEVLVHGAL
FT                   HPTSHTPDWQAPCPRCGSHRNGYPSESAVLAASTLPENIDLFRLRDFKTVIVASERFVE
FT                   AVKQLRLSDIAFRELSVRPG"
     MRFFEVLEDE ATRNTGRIDG VSPWCIPSID CTVCGGYGGL GEAYPTVDLA RFAHRALLEE        60
     PRSQQALSLE AYRHLCEQLR PWVPPAAPLE PGTQLGPVVG KAKGRFGDFY FQAPWAPWIR       120
     ISALEKLHAA GVRGLHGAPG DLGYRGQPAP PLHCLEVLVH GALHPTSHTP DWQAPCPRCG       180
     SHRNGYPSES AVLAASTLPE NIDLFRLRDF KTVIVASERF VEAVKQLRLS DIAFRELSVR       240
     PG                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page