(data stored in ACNUC30630 zone)

EMBL: CP000113.PE257

CP000113.PE257       Location/Qualifiers
FT   CDS             complement(310759..311613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0262"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87314"
FT                   /db_xref="GOA:Q1DFN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFN0"
FT                   /protein_id="ABF87314.1"
FT                   /translation="MPLHPNPPGAPVRGFERCVCSPPGGACPTLQSPMTNAELSARLLS
FT                   NVIAFKHLQRERGTLRHLGLPGVDAFCLPGHPEHSRAQQAFFHDPGALRDALPALTDFY
FT                   LRLDLPGWRVVLPPGDTEGRRVLEDAGFAPDAVRMDAMGLVLGDVPDAPPDLPLEVSET
FT                   QDDMVAINKRTWGELGGQLDVWLRPPPLPVHTLVAKEVGVALACGMARDVGDTAGIYMV
FT                   ATVPEARGRGLAAQVMRGLHHQARARRMTAAVLQATPEAKPLYQRLGYRDLGAWETWGR
FT                   TSP"
     MPLHPNPPGA PVRGFERCVC SPPGGACPTL QSPMTNAELS ARLLSNVIAF KHLQRERGTL        60
     RHLGLPGVDA FCLPGHPEHS RAQQAFFHDP GALRDALPAL TDFYLRLDLP GWRVVLPPGD       120
     TEGRRVLEDA GFAPDAVRMD AMGLVLGDVP DAPPDLPLEV SETQDDMVAI NKRTWGELGG       180
     QLDVWLRPPP LPVHTLVAKE VGVALACGMA RDVGDTAGIY MVATVPEARG RGLAAQVMRG       240
     LHHQARARRM TAAVLQATPE AKPLYQRLGY RDLGAWETWG RTSP                        284
//

If you have problems or comments...

PBIL Back to PBIL home page