(data stored in ACNUC30630 zone)

EMBL: CP000113.PE269

CP000113.PE269       Location/Qualifiers
FT   CDS             complement(328334..328741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0274"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87962"
FT                   /db_xref="GOA:Q1DFL8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL8"
FT                   /protein_id="ABF87962.1"
FT                   /translation="MSTPRRSLTPEMNVTPLVDVVLVLLIIFMVVTPQIESGAAVELPT
FT                   ATNPDKENKELTPTTVSLSATGAFFLDRKELKRDALMAELKAVRAKDPDSPVVLKADRG
FT                   VRYSEVRGLFKAMQELGFPGINLQVVDKQKN"
     MSTPRRSLTP EMNVTPLVDV VLVLLIIFMV VTPQIESGAA VELPTATNPD KENKELTPTT        60
     VSLSATGAFF LDRKELKRDA LMAELKAVRA KDPDSPVVLK ADRGVRYSEV RGLFKAMQEL       120
     GFPGINLQVV DKQKN                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page