(data stored in ACNUC30630 zone)

EMBL: CP000113.PE276

CP000113.PE276       Location/Qualifiers
FT   CDS             335489..336016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q57729; match to
FT                   protein family HMM PF07998"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92317"
FT                   /db_xref="GOA:Q1DFL1"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFL1"
FT                   /protein_id="ABF92317.1"
FT                   /translation="MPQKTLLLVSVGSPPASLLRDLQDPLAAQMGVAAVVSKTVLPTPA
FT                   YAFNKDRGQYHCNAIMRRLTPMQEPGQFAVLGISDVDLFVPDSPFVFGEADRESKTAVM
FT                   SLHRLAQGAASEMLRRRAQVEVVHQAGHLLGLSYCEDPRCVMFFAQTPQDCDRKQLSLC
FT                   NLCRNELQKLNR"
     MPQKTLLLVS VGSPPASLLR DLQDPLAAQM GVAAVVSKTV LPTPAYAFNK DRGQYHCNAI        60
     MRRLTPMQEP GQFAVLGISD VDLFVPDSPF VFGEADRESK TAVMSLHRLA QGAASEMLRR       120
     RAQVEVVHQA GHLLGLSYCE DPRCVMFFAQ TPQDCDRKQL SLCNLCRNEL QKLNR            175
//

If you have problems or comments...

PBIL Back to PBIL home page