(data stored in ACNUC30630 zone)

EMBL: CP000113.PE280

CP000113.PE280       Location/Qualifiers
FT   CDS             complement(338479..340686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0286"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89509"
FT                   /db_xref="GOA:Q1DFK7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK7"
FT                   /protein_id="ABF89509.1"
FT                   /translation="MSPIITGLLLALAIPIFVMTMSGRVGVLLAMKKENRLDNIPFRVA
FT                   QLVRFGLGQKRLVDPEEFTPGLFHVLIYAAFMVLALRTVMLFAMGFSTTALDVLTDLGH
FT                   PFWAEQSALLFVYKVYLLAKDVVAALALLGVAYYIWVRWKVKPDRLTPSWEAYLILCFI
FT                   GGLMVSEFLFGGSHMVAAHAAQAQVGAAQVPQSPAALVWWEPFTSLTGLAMMPLGATAA
FT                   HVVGAAGFWVHLVIILAFLNFLPIGKHFHIITGLPTVFFQRTHSTGKLPTPDLEKEEFG
FT                   TATVKDLTWKQGLDLYSCTECGRCQTHCPTYITGKPLTHKGVNQDLKHWIWGNEQWVEE
FT                   GYGPNGIKEPLPEIVGSALSAETVWACTSCGWCEQACPVFIENVPRLIDMRRYQVQVKA
FT                   EFPPEIQRVFEGIERQGNPWGLGQDRRDEWAEDLALPTWGDDGGPYEYLFFVGCAGSYD
FT                   DKQKKVSRALVKILREAGVSFATLSKQEMCNGDSARRMGNEYLFQTMAKTNVETWNSMG
FT                   VKAVITQCPHCFNTIKNEYPEFGGEYRVINHTQLINELLKEKRIKLSAVMNSKLTYHDP
FT                   CYLGRHNGVYDAPREVLNSIPGLEVVEMQRSKREGFCCGAGGGRMWMEEHIGTRINHNR
FT                   LNEAALTLKHAEDPNTPYPNAADKKKPGQVGDYKEKGGSGIVAVACPFCSTMLSDAVND
FT                   TGREENIKIKDITELVADALETKSGAVGTVAPSATVSAKPE"
     MSPIITGLLL ALAIPIFVMT MSGRVGVLLA MKKENRLDNI PFRVAQLVRF GLGQKRLVDP        60
     EEFTPGLFHV LIYAAFMVLA LRTVMLFAMG FSTTALDVLT DLGHPFWAEQ SALLFVYKVY       120
     LLAKDVVAAL ALLGVAYYIW VRWKVKPDRL TPSWEAYLIL CFIGGLMVSE FLFGGSHMVA       180
     AHAAQAQVGA AQVPQSPAAL VWWEPFTSLT GLAMMPLGAT AAHVVGAAGF WVHLVIILAF       240
     LNFLPIGKHF HIITGLPTVF FQRTHSTGKL PTPDLEKEEF GTATVKDLTW KQGLDLYSCT       300
     ECGRCQTHCP TYITGKPLTH KGVNQDLKHW IWGNEQWVEE GYGPNGIKEP LPEIVGSALS       360
     AETVWACTSC GWCEQACPVF IENVPRLIDM RRYQVQVKAE FPPEIQRVFE GIERQGNPWG       420
     LGQDRRDEWA EDLALPTWGD DGGPYEYLFF VGCAGSYDDK QKKVSRALVK ILREAGVSFA       480
     TLSKQEMCNG DSARRMGNEY LFQTMAKTNV ETWNSMGVKA VITQCPHCFN TIKNEYPEFG       540
     GEYRVINHTQ LINELLKEKR IKLSAVMNSK LTYHDPCYLG RHNGVYDAPR EVLNSIPGLE       600
     VVEMQRSKRE GFCCGAGGGR MWMEEHIGTR INHNRLNEAA LTLKHAEDPN TPYPNAADKK       660
     KPGQVGDYKE KGGSGIVAVA CPFCSTMLSD AVNDTGREEN IKIKDITELV ADALETKSGA       720
     VGTVAPSATV SAKPE                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page