(data stored in ACNUC30630 zone)

EMBL: CP000113.PE281

CP000113.PE281       Location/Qualifiers
FT   CDS             341231..341392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88571"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK6"
FT                   /protein_id="ABF88571.1"
FT                   /translation="MVHDDTTYMDDEGLPYVDPRQDGGAESSEADEGAPGRRWGYSEES
FT                   WGGWAAAE"
     MVHDDTTYMD DEGLPYVDPR QDGGAESSEA DEGAPGRRWG YSEESWGGWA AAE               53
//

If you have problems or comments...

PBIL Back to PBIL home page