(data stored in ACNUC30630 zone)

EMBL: CP000113.PE284

CP000113.PE284       Location/Qualifiers
FT   CDS             345476..346057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91905.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90040"
FT                   /db_xref="GOA:Q1DFK3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFK3"
FT                   /protein_id="ABF90040.1"
FT                   /translation="MKQVFTALALGTLLIGAPALADAEVGKPAPTFTLKDESGKEHTLA
FT                   QYKGKVVVLEWTNPECPFVQRHYKNDTMVTTLKGFDAKKVVWLAVDSTAHNTPEKSAAW
FT                   KKDEGFPYPVLQDASGTVGKSYGAKTTPHMYVIDETGVVRYAGAIDDDPRGKNAKPANH
FT                   VKTAVDAVVGGQQVPASTTTPYGCSVKYKS"
     MKQVFTALAL GTLLIGAPAL ADAEVGKPAP TFTLKDESGK EHTLAQYKGK VVVLEWTNPE        60
     CPFVQRHYKN DTMVTTLKGF DAKKVVWLAV DSTAHNTPEK SAAWKKDEGF PYPVLQDASG       120
     TVGKSYGAKT TPHMYVIDET GVVRYAGAID DDPRGKNAKP ANHVKTAVDA VVGGQQVPAS       180
     TTTPYGCSVK YKS                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page