(data stored in ACNUC30630 zone)

EMBL: CP000113.PE288

CP000113.PE288       Location/Qualifiers
FT   CDS             348442..348816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFJ9"
FT                   /protein_id="ABF89097.1"
FT                   /translation="MTWAVIRYHPPGPFQLVGRKARHRTMDAWTLEGSRITDPDTLSRL
FT                   REMLANKSPLIIEHRFYRETRAPHRFICDDADVLDEYLQESRPGDSFCVWSYKSLCRGD
FT                   NLLLQGKMPDAQGRTPGGVA"
     MTWAVIRYHP PGPFQLVGRK ARHRTMDAWT LEGSRITDPD TLSRLREMLA NKSPLIIEHR        60
     FYRETRAPHR FICDDADVLD EYLQESRPGD SFCVWSYKSL CRGDNLLLQG KMPDAQGRTP       120
     GGVA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page