(data stored in ACNUC30630 zone)

EMBL: CP000113.PE298

CP000113.PE298       Location/Qualifiers
FT   CDS             complement(358250..360394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0304"
FT                   /product="putative sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86169"
FT                   /db_xref="GOA:Q1DFI9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFI9"
FT                   /protein_id="ABF86169.1"
FT                   /translation="MRGSSPAVCMQPAGSPPLTMHARPERHHPLWASRAGRYGVALLAF
FT                   VAAWLIQAGTMSFIPATPFLFFFGAVMVSGWWGGWGPALATTLLSVVVVDFYFLEPLLN
FT                   LMPGTGGAVSLAVFVVLALLMTKLNVMLRKANAERARLLERERAARSEAEAGQARLHAL
FT                   FRDAPAAIILMHGPRHIYSFSNTMNNTLMGTDTLVGQEASKALPWAESRGFITLLDEVY
FT                   RTGVPFTGNAVPFPRKPPHDEIQETYLNIVYQPTRNEQGEVDGIAGFGFDVTDLVRARQ
FT                   RAEALTHELQLAEARDWLLAESGAVLASSLDDETTLRNMAKLVVPTFADWCLVDVAEPD
FT                   GTFRRLEAAHFRLEDDALAEDILRFGMQPSGNPGHPPTGALLKAETVHVERLTRERIHE
FT                   LAHDAEHARVLEAIGPVSFIAVPLIARGQVLGVLSFIHAHSGRHYSTSDLAFAKELAHR
FT                   AALSLENARLYAEAREAIRLRDEFMSIASHELKTPLTPLSLKLQALSRELARHPGPVPR
FT                   NLVESYVAVGARQVQKLAELVGDLLDVSRISAGRLSLELEELELGSLVRDVVTRYEPQA
FT                   ARTGSPLQLEAGDFDIVGRWDRLRLEQVITNLVDNAVKYGNGRPIHVRLEPHDGGARLT
FT                   VRDEGIGIEPQHLPRLFGRFERAVSERNYGGLGLGLYITRTLVEAMGGRVHVESRLGRG
FT                   STFTVELPSHLGAEQARQAP"
     MRGSSPAVCM QPAGSPPLTM HARPERHHPL WASRAGRYGV ALLAFVAAWL IQAGTMSFIP        60
     ATPFLFFFGA VMVSGWWGGW GPALATTLLS VVVVDFYFLE PLLNLMPGTG GAVSLAVFVV       120
     LALLMTKLNV MLRKANAERA RLLERERAAR SEAEAGQARL HALFRDAPAA IILMHGPRHI       180
     YSFSNTMNNT LMGTDTLVGQ EASKALPWAE SRGFITLLDE VYRTGVPFTG NAVPFPRKPP       240
     HDEIQETYLN IVYQPTRNEQ GEVDGIAGFG FDVTDLVRAR QRAEALTHEL QLAEARDWLL       300
     AESGAVLASS LDDETTLRNM AKLVVPTFAD WCLVDVAEPD GTFRRLEAAH FRLEDDALAE       360
     DILRFGMQPS GNPGHPPTGA LLKAETVHVE RLTRERIHEL AHDAEHARVL EAIGPVSFIA       420
     VPLIARGQVL GVLSFIHAHS GRHYSTSDLA FAKELAHRAA LSLENARLYA EAREAIRLRD       480
     EFMSIASHEL KTPLTPLSLK LQALSRELAR HPGPVPRNLV ESYVAVGARQ VQKLAELVGD       540
     LLDVSRISAG RLSLELEELE LGSLVRDVVT RYEPQAARTG SPLQLEAGDF DIVGRWDRLR       600
     LEQVITNLVD NAVKYGNGRP IHVRLEPHDG GARLTVRDEG IGIEPQHLPR LFGRFERAVS       660
     ERNYGGLGLG LYITRTLVEA MGGRVHVESR LGRGSTFTVE LPSHLGAEQA RQAP             714
//

If you have problems or comments...

PBIL Back to PBIL home page