(data stored in ACNUC30630 zone)

EMBL: CP000113.PE310

CP000113.PE310       Location/Qualifiers
FT   CDS             complement(371958..373157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04339"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92724"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFH7"
FT                   /protein_id="ABF92724.1"
FT                   /translation="MPADTPLRLRILEAVTDAPAEGWDALVGPDAPPFVRHAWLAAMEE
FT                   SGSATEETGWAPHHLTLWRGPKLVAAAPAYLKFHSMGEYIYDFGWADAAARLGVEYYPK
FT                   LVVGGPLSPATVPRFLIAPGEDVPALRRALLAAAAGSAQEAGCSSVHVLYPTGDEADFL
FT                   EAEGLARRITLQFHWKNPGYGSYDDYLARFDSKRRNQLKRERGAAATQGISLRTVRGEG
FT                   LSQAHARRAYGFYTSTCERHAWGQIQLTPDFFARVFRTMPGSVELVEAVRGQQVIAGAF
FT                   NLATPERLYGRYWGAFEEHPFLHFHVCLYHSVEDCIRTGRKVFEPGAGGEHKVSRGFEP
FT                   TAVHSAHLIFDKTLDGAVRGFLRREHARLAPAVEEAERICGLKPWPLAASPGTQGATGT
FT                   "
     MPADTPLRLR ILEAVTDAPA EGWDALVGPD APPFVRHAWL AAMEESGSAT EETGWAPHHL        60
     TLWRGPKLVA AAPAYLKFHS MGEYIYDFGW ADAAARLGVE YYPKLVVGGP LSPATVPRFL       120
     IAPGEDVPAL RRALLAAAAG SAQEAGCSSV HVLYPTGDEA DFLEAEGLAR RITLQFHWKN       180
     PGYGSYDDYL ARFDSKRRNQ LKRERGAAAT QGISLRTVRG EGLSQAHARR AYGFYTSTCE       240
     RHAWGQIQLT PDFFARVFRT MPGSVELVEA VRGQQVIAGA FNLATPERLY GRYWGAFEEH       300
     PFLHFHVCLY HSVEDCIRTG RKVFEPGAGG EHKVSRGFEP TAVHSAHLIF DKTLDGAVRG       360
     FLRREHARLA PAVEEAERIC GLKPWPLAAS PGTQGATGT                              399
//

If you have problems or comments...

PBIL Back to PBIL home page