(data stored in ACNUC30630 zone)

EMBL: CP000113.PE318

CP000113.PE318       Location/Qualifiers
FT   CDS             387369..387986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87013"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG9"
FT                   /protein_id="ABF87013.1"
FT                   /translation="MDASSGKSGRPRNRGWTSDPDEIFGSSSRRSHTMKKTRDEALNLQ
FT                   EVGDMEARWRGLATQLLELGDDAMDAQLLVAFRAAREEGVVPPDAGFFLVAHILTAMAD
FT                   EAIGDEPRVCRLALELELMEREYGVEQGVWLSGEETPPEDWEALRAAYEAACDEARATF
FT                   FTAYGEEEMARLYLDDRICFHRRFESGRRFFHGLPMLPEHLH"
     MDASSGKSGR PRNRGWTSDP DEIFGSSSRR SHTMKKTRDE ALNLQEVGDM EARWRGLATQ        60
     LLELGDDAMD AQLLVAFRAA REEGVVPPDA GFFLVAHILT AMADEAIGDE PRVCRLALEL       120
     ELMEREYGVE QGVWLSGEET PPEDWEALRA AYEAACDEAR ATFFTAYGEE EMARLYLDDR       180
     ICFHRRFESG RRFFHGLPML PEHLH                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page