(data stored in ACNUC30630 zone)

EMBL: CP000113.PE319

CP000113.PE319       Location/Qualifiers
FT   CDS             388392..389147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91791.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88274"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFG8"
FT                   /protein_id="ABF88274.1"
FT                   /translation="MTTDSAHRLLDLLWERYAAEVPYARTFVQLSGGRFRNDHVALRSL
FT                   ARPGGGIALFSQSFIRLGWKAAGAYTFPDAHLSAIYLSHPAGLPRIFISELKQEELSPR
FT                   ARELLARLPEDPAPPEDVDALAAWFGSPPPPDEAALLELEKESQYGAWLLAFGRKVNHF
FT                   TGSVDDVEAWQKRMREAGVPMKADIEGAPGTSLRQTATQAAPLPVLLEGGGSRSWPYAY
FT                   FEIAQRTPDFDGFLGPQARALFDMTKRGG"
     MTTDSAHRLL DLLWERYAAE VPYARTFVQL SGGRFRNDHV ALRSLARPGG GIALFSQSFI        60
     RLGWKAAGAY TFPDAHLSAI YLSHPAGLPR IFISELKQEE LSPRARELLA RLPEDPAPPE       120
     DVDALAAWFG SPPPPDEAAL LELEKESQYG AWLLAFGRKV NHFTGSVDDV EAWQKRMREA       180
     GVPMKADIEG APGTSLRQTA TQAAPLPVLL EGGGSRSWPY AYFEIAQRTP DFDGFLGPQA       240
     RALFDMTKRG G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page