(data stored in ACNUC30630 zone)

EMBL: CP000113.PE33

CP000113.PE33        Location/Qualifiers
FT   CDS             complement(43139..43900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0036"
FT                   /product="putative aliphatic sulfonates ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to PIR:B96913; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89477"
FT                   /db_xref="GOA:Q1DGA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA4"
FT                   /protein_id="ABF89477.1"
FT                   /translation="MKHHAQKLLVIALLIGLWELVARMGIWSPHLLPRPLTVAQSLVAM
FT                   VTDGRLVGAAGRSLGRLLRAYLMSVALGVPLGLLISRIPFFRNAVKPVVMGLQALPSIC
FT                   WLPLALLWFGLTDGAILFVVVMGSVLGIAIATEDSVNGVDPQLTRVASTLGVRGLRFQF
FT                   GVLLPAALPGIVTGLKLGWSFAWRALLAGELLFVSGGLGQLLTVGRELMDVPQVMAVMV
FT                   AIVIIGTAVDRVLFQTVEVRLRRRWGLTATT"
     MKHHAQKLLV IALLIGLWEL VARMGIWSPH LLPRPLTVAQ SLVAMVTDGR LVGAAGRSLG        60
     RLLRAYLMSV ALGVPLGLLI SRIPFFRNAV KPVVMGLQAL PSICWLPLAL LWFGLTDGAI       120
     LFVVVMGSVL GIAIATEDSV NGVDPQLTRV ASTLGVRGLR FQFGVLLPAA LPGIVTGLKL       180
     GWSFAWRALL AGELLFVSGG LGQLLTVGRE LMDVPQVMAV MVAIVIIGTA VDRVLFQTVE       240
     VRLRRRWGLT ATT                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page