(data stored in ACNUC30630 zone)

EMBL: CP000113.PE345

CP000113.PE345       Location/Qualifiers
FT   CDS             419473..420297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86778"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFE2"
FT                   /protein_id="ABF86778.1"
FT                   /translation="MSLMRVWLMCVALATAPSVGLAETSKPAAPKGRPSAEAKAGKAPP
FT                   KKAPAAGAKPAPAPAPGQDAGTPPARPSFRWDIPAVTAWVESPGLQVTDGVPMHLQLAR
FT                   TSWQMDPLIQHMVDRFRAAGLFISSSPEALNSPIAEPMLTALDTETLTAYTVIFQKNQD
FT                   NTVTLILGTSDVSKYTPGGSIQLDWAPVMAGAEQVTRSNLEGSQMAMYAVKATSAEVRE
FT                   FYQVELTRAGFVEDREQPGVFQRGTEQLTIRTQPEGDMLMVGLYRKLGVQPK"
     MSLMRVWLMC VALATAPSVG LAETSKPAAP KGRPSAEAKA GKAPPKKAPA AGAKPAPAPA        60
     PGQDAGTPPA RPSFRWDIPA VTAWVESPGL QVTDGVPMHL QLARTSWQMD PLIQHMVDRF       120
     RAAGLFISSS PEALNSPIAE PMLTALDTET LTAYTVIFQK NQDNTVTLIL GTSDVSKYTP       180
     GGSIQLDWAP VMAGAEQVTR SNLEGSQMAM YAVKATSAEV REFYQVELTR AGFVEDREQP       240
     GVFQRGTEQL TIRTQPEGDM LMVGLYRKLG VQPK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page