(data stored in ACNUC30630 zone)

EMBL: CP000113.PE354

CP000113.PE354       Location/Qualifiers
FT   CDS             432780..434201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0366"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90514"
FT                   /db_xref="GOA:Q1DFD3"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFD3"
FT                   /protein_id="ABF90514.1"
FT                   /translation="MSSAISPLSTPESDSMKKTLTSLLCAAVSLTLLSLACGEGNPPQV
FT                   PQPLEDGGVLWTECSPEGAREDCSQGESCIFVASHDRHLCVRACDSQTACEHPDAVCCP
FT                   SSGEGAEGGHCVPSNACVPTDAGVDGGSNEETDGGTQEEDAGVDPEPDAGTDPEPDAGV
FT                   DPEPDAGTEPDAGTDAGTDAGTDAGTDAGTDAGTDAGTDAGTDGGTDAGHTPIRVMASN
FT                   LSSGNYQSYDPGHGIRLIKGVHPDIVLMQEFNYGSNSASDIRSLVDQIAPGFHYSRETG
FT                   AQIPNGIISRWPIIQFGQWPDPRVSNRDFAWARIDIPGPRDLWAVSVHLLTSSSSNRNA
FT                   EAQSIVNEVRSQIPEDDYLVIGGDLNTDSFSESCFATFRQVVTTAGPHPADHNGNTGTN
FT                   SNRNKPYDQILVDQDLRQYQQATVIGSSTFPNGLVLDSRTYRPLSEIAPVQSGDSSSSN
FT                   MQHMGVVKDFLVPNF"
     MSSAISPLST PESDSMKKTL TSLLCAAVSL TLLSLACGEG NPPQVPQPLE DGGVLWTECS        60
     PEGAREDCSQ GESCIFVASH DRHLCVRACD SQTACEHPDA VCCPSSGEGA EGGHCVPSNA       120
     CVPTDAGVDG GSNEETDGGT QEEDAGVDPE PDAGTDPEPD AGVDPEPDAG TEPDAGTDAG       180
     TDAGTDAGTD AGTDAGTDAG TDAGTDGGTD AGHTPIRVMA SNLSSGNYQS YDPGHGIRLI       240
     KGVHPDIVLM QEFNYGSNSA SDIRSLVDQI APGFHYSRET GAQIPNGIIS RWPIIQFGQW       300
     PDPRVSNRDF AWARIDIPGP RDLWAVSVHL LTSSSSNRNA EAQSIVNEVR SQIPEDDYLV       360
     IGGDLNTDSF SESCFATFRQ VVTTAGPHPA DHNGNTGTNS NRNKPYDQIL VDQDLRQYQQ       420
     ATVIGSSTFP NGLVLDSRTY RPLSEIAPVQ SGDSSSSNMQ HMGVVKDFLV PNF              473
//

If you have problems or comments...

PBIL Back to PBIL home page