(data stored in ACNUC30630 zone)

EMBL: CP000113.PE361

CP000113.PE361       Location/Qualifiers
FT   CDS             439372..439464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0373"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC6"
FT                   /protein_id="ABF89168.1"
FT                   /translation="MAKMQPIFKPGEDGMLPSSLIERGLCRPAP"
     MAKMQPIFKP GEDGMLPSSL IERGLCRPAP                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page