(data stored in ACNUC30630 zone)

EMBL: CP000113.PE372

CP000113.PE372       Location/Qualifiers
FT   CDS             complement(448779..449168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0386"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90142"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFB5"
FT                   /protein_id="ABF90142.1"
FT                   /translation="MKLGYIILYVPDVSAAIVFYEKAFGLARRFIHESGGYAEMETGTT
FT                   ALAFVEEGAAKEHGFTVRHLRPKEDAAAIELALVTPDVATAYTRAVEAGAEATQPPKQK
FT                   PWGQTVAYVRDINGVLVELCSPMEG"
     MKLGYIILYV PDVSAAIVFY EKAFGLARRF IHESGGYAEM ETGTTALAFV EEGAAKEHGF        60
     TVRHLRPKED AAAIELALVT PDVATAYTRA VEAGAEATQP PKQKPWGQTV AYVRDINGVL       120
     VELCSPMEG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page