(data stored in ACNUC30630 zone)

EMBL: CP000113.PE38

CP000113.PE38        Location/Qualifiers
FT   CDS             47274..49139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0041"
FT                   /product="glycosyl hydrolase, family 15"
FT                   /note="identified by match to protein family HMM PF00723"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91930"
FT                   /db_xref="GOA:Q1DG99"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG99"
FT                   /protein_id="ABF91930.1"
FT                   /translation="MATGSGGASVTGQPVAIEDHGVIGDLRTVALVGHEGTIDWFCFPH
FT                   FDSPSVFAALLDREKGGHWGVAPEPDGVMKRQFYWPETNVLVTRFYTPDGVGELVDFMP
FT                   MSGRKGMKEEREILRRVRVVRGQMVFRMECFPAFNYARDTHETKLIHSGATFSSDTLQL
FT                   TLSSSVSLKKTERGVTASFTLHENQSAVFSLHPGARTSCEAVVHNHESSEELFRETVEY
FT                   WRHWLSGCQYTGRWRETVQRSALALKLMTFAPTGAIVAAPTCSLPESPGGTRNWDYRFC
FT                   WLRDAAFTVYAFLRIGFKQEAAAFMRWVEARCAEYDEGPLPLMFGIDGKRVPEEQELLH
FT                   LSGYGGARPVRIGNAAADQLQLDIYGELMDSVYLSNKYAAPISYDFWRHLRRLVDWVCD
FT                   NWELPDEGIWEVRGGQRQFVYSKLMCWVAVDRAIRLADKRSFPADRARWHKVRDAIFED
FT                   IMDKGWNPERGAFVQYYGGHALDAANLLMPLVFFLSPVDPRMLQTLDVMRKPPSQGGLA
FT                   SDGLVFRYDVEATLDGIAGSEGTFNLCSFWLVEAMTRASVARPDLLEEARLIFERMLGY
FT                   ANHVGLYAEQTGMSGEALGNFPQALTHLALISSAYNLDRTLGRRD"
     MATGSGGASV TGQPVAIEDH GVIGDLRTVA LVGHEGTIDW FCFPHFDSPS VFAALLDREK        60
     GGHWGVAPEP DGVMKRQFYW PETNVLVTRF YTPDGVGELV DFMPMSGRKG MKEEREILRR       120
     VRVVRGQMVF RMECFPAFNY ARDTHETKLI HSGATFSSDT LQLTLSSSVS LKKTERGVTA       180
     SFTLHENQSA VFSLHPGART SCEAVVHNHE SSEELFRETV EYWRHWLSGC QYTGRWRETV       240
     QRSALALKLM TFAPTGAIVA APTCSLPESP GGTRNWDYRF CWLRDAAFTV YAFLRIGFKQ       300
     EAAAFMRWVE ARCAEYDEGP LPLMFGIDGK RVPEEQELLH LSGYGGARPV RIGNAAADQL       360
     QLDIYGELMD SVYLSNKYAA PISYDFWRHL RRLVDWVCDN WELPDEGIWE VRGGQRQFVY       420
     SKLMCWVAVD RAIRLADKRS FPADRARWHK VRDAIFEDIM DKGWNPERGA FVQYYGGHAL       480
     DAANLLMPLV FFLSPVDPRM LQTLDVMRKP PSQGGLASDG LVFRYDVEAT LDGIAGSEGT       540
     FNLCSFWLVE AMTRASVARP DLLEEARLIF ERMLGYANHV GLYAEQTGMS GEALGNFPQA       600
     LTHLALISSA YNLDRTLGRR D                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page