(data stored in ACNUC30630 zone)

EMBL: CP000113.PE4

CP000113.PE4         Location/Qualifiers
FT   CDS             complement(4009..4620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91172"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD3"
FT                   /protein_id="ABF91172.1"
FT                   /translation="MPPVLGSLPALASRRAGGGRCLGNVGCPRSGKRPKPDTGEATVMA
FT                   NIREEQGEAAEGRSATPSLKEQRSESHAAQTYMAFLKDLEANAGVVRGLAEKAAQSVLC
FT                   LLEQRLMDTEAKHLEAQLPRKVRDMLKRCPRHEGKVARKYKLEQFLAMVAEELDTTPNE
FT                   AERLARAVFVTVRNHISEGEADDVMGQLPADLRSLWVPEA"
     MPPVLGSLPA LASRRAGGGR CLGNVGCPRS GKRPKPDTGE ATVMANIREE QGEAAEGRSA        60
     TPSLKEQRSE SHAAQTYMAF LKDLEANAGV VRGLAEKAAQ SVLCLLEQRL MDTEAKHLEA       120
     QLPRKVRDML KRCPRHEGKV ARKYKLEQFL AMVAEELDTT PNEAERLARA VFVTVRNHIS       180
     EGEADDVMGQ LPADLRSLWV PEA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page